LXL04_035156 | RubberDandelionOmics

Gene overview

LXL04_035156

Reference: OH-1004 Chr: Chr08 Coordinates: 15888498-15894151 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3438 bp · LXL04_035156|LXL04_035156|OH1004|cDNA

ATGAACAGAGAAAGTTTCGGTTTAGGAGAACTATCAGATGAGCAAAGGGCTCGAATTTCCAGAAATTTCAGAGCTGCGAAGGCTCTTCTTGATCGCAAGCGCCCTCGAGACGCCTCCAGCCCCTCCAATTACTCTCCTCGAAAAATCGGGATTGTGAAGGAGGCTATAACTCCATCGGATGCTGGCAGTGTGAATAGAGTGCCTCTTTCAAACATTTCAGTGAATACTCCCACTCCTGTTAGGAATCTTAAGTTGAATCA...

CDS

Download CDS FASTA

3438 bp · LXL04_035156|LXL04_035156|OH1004|CDS

ATGAACAGAGAAAGTTTCGGTTTAGGAGAACTATCAGATGAGCAAAGGGCTCGAATTTCCAGAAATTTCAGAGCTGCGAAGGCTCTTCTTGATCGCAAGCGCCCTCGAGACGCCTCCAGCCCCTCCAATTACTCTCCTCGAAAAATCGGGATTGTGAAGGAGGCTATAACTCCATCGGATGCTGGCAGTGTGAATAGAGTGCCTCTTTCAAACATTTCAGTGAATACTCCCACTCCTGTTAGGAATCTTAAGTTGAATCA...

Protein

Download Protein FASTA

1145 aa · LXL04_035156|LXL04_035156|OH1004|PROTEIN

MNRESFGLGELSDEQRARISRNFRAAKALLDRKRPRDASSPSNYSPRKIGIVKEAITPSDAGSVNRVPLSNISVNTPTPVRNLKLNQNGCLSSSNFKVPCVSKTEMRVLADEKEKEKFHSSFHTPIRQINNSETSFQTPISYNGGSHTPKENNPSLDSFKTPIRPVNSNVTPVSQKPCSTFNDSSTIMPSIFYEDFDDFFLAEVDELCESRTKSKIVTADSTPDIQSKKTHTENSNHELKLNLSPVGIDKFQNDNIFEGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035156`
TK1151 ID	TkA04G162320
OH-1004 ID	LXL04_035156
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035156

Location Chr08:15888498-15894151 (+)

Description Similar to SRS2: ATP-dependent DNA helicase SRS2-like protein At4g25120

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25120`	ATP-dependent 3'- to 5'-DNA helicase that could disrupt recombinogenic DNA intermediates and facilitate single strand annealing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035156 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000725 recombinational repair Biological Process

GO:0006260 DNA replication Biological Process

GO:0006310 DNA recombination Biological Process

GO:0009314 response to radiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0033202 DNA helicase complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003678 DNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0043138 3'-5' DNA helicase activity Molecular Function

KEGG gene cross-reference

ath:AT4G25120

sau:SA1721

sav:SAV1905

sep:SE_1590

ser:SERP1443

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.792

Rank 1 · LXL04_035156 · OH-1004

Cytoplasm0.213

Rank 2 · LXL04_035156 · OH-1004

Mitochondrion0.090

Rank 3 · LXL04_035156 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_035156 · OH-1004

Plastid0.010

Rank 5 · LXL04_035156 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00580.28UvrD-helicase271-538 aa

PF13245.13AAA_19286-522 aa

PF13361.13UvrD_C543-919 aa

PF01443.25Viral_helicase1837-917 aa

PF13538.13UvrD_C_2853-878 aa

PF13538.13UvrD_C_2893-916 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035156	`PF00580.28`	UvrD-helicase	271	538	3e-66	224.6
LXL04_035156	`PF13245.13`	AAA_19	286	522	3.2e-23	83.1
LXL04_035156	`PF13361.13`	UvrD_C	543	919	5.8e-45	155.0
LXL04_035156	`PF01443.25`	Viral_helicase1	837	917	3.9e-07	30.8
LXL04_035156	`PF13538.13`	UvrD_C_2	853	878	7.1e-14	52.1
LXL04_035156	`PF13538.13`	UvrD_C_2	893	916	7.1e-14	52.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`D1KF50`	Arabidopsis thaliana	ATP-dependent DNA helicase SRS2-like protein At4g25120	57.895%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card