LXL04_035105 | RubberDandelionOmics

Gene overview

LXL04_035105

Reference: OH-1004 Chr: Chr08 Coordinates: 14546087-14547550 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_035105|LXL04_035105|OH1004|cDNA

ATGTTTATCAACAGAAATACACAAATGGTTCGTTCTAGTCAACCTTCCAACACAGTCGTCCCTTCATCAATGGAGTCCTCCAGAAAAAGAAAGTCGCGAAGTAGACGCGAAGGCCCAAAGGGTGTAGCAGAAACTCTCGCCAAATGGAAGGAATACAACAACAAAATCGACAAATTGGACGAAAAAGCCAAACCAACACGTAAAGTCCCCGCCAAGGGGTCGAAGAAAGGGTGCATGAAAGGCAAAGGAGGACCCGACAA...

CDS

Download CDS FASTA

1023 bp · LXL04_035105|LXL04_035105|OH1004|CDS

ATGTTTATCAACAGAAATACACAAATGGTTCGTTCTAGTCAACCTTCCAACACAGTCGTCCCTTCATCAATGGAGTCCTCCAGAAAAAGAAAGTCGCGAAGTAGACGCGAAGGCCCAAAGGGTGTAGCAGAAACTCTCGCCAAATGGAAGGAATACAACAACAAAATCGACAAATTGGACGAAAAAGCCAAACCAACACGTAAAGTCCCCGCCAAGGGGTCGAAGAAAGGGTGCATGAAAGGCAAAGGAGGACCCGACAA...

Protein

Download Protein FASTA

340 aa · LXL04_035105|LXL04_035105|OH1004|PROTEIN

MFINRNTQMVRSSQPSNTVVPSSMESSRKRKSRSRREGPKGVAETLAKWKEYNNKIDKLDEKAKPTRKVPAKGSKKGCMKGKGGPDNSRCNFRGVRQRTWGKWVAEIREPNRGSRLWLGTFGSAVEAALAYDEAARVMYGPCARLNLPNCRTISEYSPAVPNGASSCDSTTTCSHSEDSKNVSDRETVKDDCESDSPSDQSGNLPSPAFKQDVRVKEEPAEIGDYDFQNLHVDELFDMEELLELMGQKSPGLKPDPGIDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035105`
TK1151 ID	TkA04G167620
OH-1004 ID	LXL04_035105
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035105

Location Chr08:14546087-14547550 (-)

Description Similar to DREB2A: Dehydration-responsive element-binding protein 2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40340`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`At5g05410`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	DNA-binding specificity of the ERF/AP2 domain of Arabidopsis DREBs, transcription factors involved in dehydration- and cold-inducible gene expression.2002 · DOI: 10.1006/bbrc.2001.6299 Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.2014 · DOI: 10.1105/tpc.114.132928
`At2g40350`	Putative transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WL19`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`Os01g0165000`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3' of the cis-acting dehydration-responsive element (DRE).	OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression.2003 · DOI: 10.1046/j.1365-313x.2003.01661.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035105 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G40340

ath:AT2G40350

ath:AT5G05410

dosa:Os01g0165000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_035105 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_035105 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_035105 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_035105 · OH-1004

Plastid0.013

Rank 5 · LXL04_035105 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP291-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035105	`PF00847.27`	AP2	91	140	3.7e-14	53.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFR2`	Arabidopsis thaliana	Dehydration-responsive element-binding protein 2C	38.000%	Swiss-Prot	moderate database homology
`O82132`	Arabidopsis thaliana	Dehydration-responsive element-binding protein 2A	71.654%	Swiss-Prot	weak database homology
`Q9SIZ0`	Arabidopsis thaliana	Putative dehydration-responsive element-binding protein 2H	63.200%	Swiss-Prot	weak database homology
`A2WL19`	Oryza sativa subsp. indica	Dehydration-responsive element-binding protein 2A	49.451%	Swiss-Prot	moderate database homology
`Q0JQF7`	Oryza sativa subsp. japonica	Dehydration-responsive element-binding protein 2A	49.451%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card