LXL04_035058 | RubberDandelionOmics

Gene overview

LXL04_035058

Reference: OH-1004 Chr: Chr08 Coordinates: 13072343-13073480 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_035058|LXL04_035058|OH1004|cDNA

ATGACTACAGCGGCAGCTGCAGGGGCGGCGACCGGTTCTGGTTCTGAAACTCGAAATTCCCGATGGTCTCTAGCCGGAATGACTGCTCTCGTTACCGGTGGTACACGTGGGATCGGCCACGCAGTGGTGGAGGAATTGGCGGAGTTAGGGGCGGCGGTACACACCTGCTCTCGCAACGAGGCCGAGCTCAACCAACGTCTCCAAGAATGGTCGACCAAGGGCTTCACCGTCACCGGATCCGTCTGCGATGCAACTTCTAC...

CDS

Download CDS FASTA

825 bp · LXL04_035058|LXL04_035058|OH1004|CDS

ATGACTACAGCGGCAGCTGCAGGGGCGGCGACCGGTTCTGGTTCTGAAACTCGAAATTCCCGATGGTCTCTAGCCGGAATGACTGCTCTCGTTACCGGTGGTACACGTGGGATCGGCCACGCAGTGGTGGAGGAATTGGCGGAGTTAGGGGCGGCGGTACACACCTGCTCTCGCAACGAGGCCGAGCTCAACCAACGTCTCCAAGAATGGTCGACCAAGGGCTTCACCGTCACCGGATCCGTCTGCGATGCAACTTCTAC...

Protein

Download Protein FASTA

274 aa · LXL04_035058|LXL04_035058|OH1004|PROTEIN

MTTAAAAGAATGSGSETRNSRWSLAGMTALVTGGTRGIGHAVVEELAELGAAVHTCSRNEAELNQRLQEWSTKGFTVTGSVCDATSTPDRKRLLEKVSSIFNGKLNILINNVGTTIVKPALEYTSEEYSLIMATNLESGYHMSQLAHPFLKASGFGSIVFISSVAGSIQINCTSIYGPTKAAMNQLATNLACEWAKDNIRSNSVAPGCTRTPLVEPLLSNQEFLDTMVSRIPMKRIAEVNEVSSMVAFLCMPAASYITGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035058`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035058

Location Chr08:13072343-13073480 (-)

Description Similar to SDR: Tropinone reductase homolog At2g29360

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29360`	Oxidoreductase active on cyclic ketones, but not on tropinone or nortropinone.	No verified direct reference in this release
`At5g06060`	Tropinone reductase homolog At5g06060.	No verified direct reference in this release
`At2g29350`	Unspecific reductase providing both diastereomeric alcohols from the prochiral ketones.	No verified direct reference in this release
`At2g29290`	Tropinone reductase homolog At2g29290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035058 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050356 tropine dehydrogenase activity Molecular Function

GO:0050358 tropinone reductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G29290

ath:AT2G29350

ath:AT2G29360

ath:AT5G06060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.401

Rank 1 · LXL04_035058 · OH-1004

Cytoplasm0.302

Rank 2 · LXL04_035058 · OH-1004

Peroxisome0.271

Rank 3 · LXL04_035058 · OH-1004

Nucleus0.100

Rank 4 · LXL04_035058 · OH-1004

Plastid0.066

Rank 5 · LXL04_035058 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short28-220 aa

PF08659.17KR28-189 aa

PF13561.13adh_short_C236-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035058	`PF00106.32`	adh_short	28	220	1.5e-48	165.6
LXL04_035058	`PF08659.17`	KR	28	189	2.2e-11	44.7
LXL04_035058	`PF13561.13`	adh_short_C2	36	269	6.5e-58	196.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW19`	Arabidopsis thaliana	Tropinone reductase homolog At2g29360	66.031%	Swiss-Prot	strong database homology
`Q9LHT0`	Arabidopsis thaliana	Tropinone reductase homolog At5g06060	65.882%	Swiss-Prot	strong database homology
`Q9ZW18`	Arabidopsis thaliana	Senescence-associated protein 13	65.625%	Swiss-Prot	strong database homology
`Q9ZW13`	Arabidopsis thaliana	Tropinone reductase homolog At2g29290	63.137%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card