LXL04_035049 | RubberDandelionOmics

Gene overview

LXL04_035049

Reference: OH-1004 Chr: Chr08 Coordinates: 12320250-12323342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · LXL04_035049|LXL04_035049|OH1004|cDNA

atggctatttcaaaaactCCGTCCCTCCATCTCCACCACCTCCTTTTCCTCCTCCTAGTGGCACCGGCCGTCAACTCTATCGGCGTTAACTACGGCACCCTAGGCGACAACCTCCCACCACCAGCTACAGTAGCCCGTTTCCTCAAAACAAACACCATCATCGACCGCATTCGAATCTTTGACGTCAACCCAGATATAATTAAAGCTTTCGCCGGAACCGACATCCTCGTCTCCGTCACAGTCCCCAACGGCGACATCCC...

CDS

Download CDS FASTA

1383 bp · LXL04_035049|LXL04_035049|OH1004|CDS

ATGGCTATTTCAAAAACTCCGTCCCTCCATCTCCACCACCTCCTTTTCCTCCTCCTAGTGGCACCGGCCGTCAACTCTATCGGCGTTAACTACGGCACCCTAGGCGACAACCTCCCACCACCAGCTACAGTAGCCCGTTTCCTCAAAACAAACACCATCATCGACCGCATTCGAATCTTTGACGTCAACCCAGATATAATTAAAGCTTTCGCCGGAACCGACATCCTCGTCTCCGTCACAGTCCCCAACGGCGACATCCC...

Protein

Download Protein FASTA

460 aa · LXL04_035049|LXL04_035049|OH1004|PROTEIN

MAISKTPSLHLHHLLFLLLVAPAVNSIGVNYGTLGDNLPPPATVARFLKTNTIIDRIRIFDVNPDIIKAFAGTDILVSVTVPNGDIPSLTDPWNARRWVNSNIKPFYPATKIHYICVGTEVLHWGPQNIVDNLVPAMRVLHAALVKAGIEDIKISSPHSLSILSSSTPPSNASFRHGWDVGTLAPMLRFHRQTKSGFMVNPYTYYGYTPALENFCLFKPNNGLFDKVTGKRYTNQFDQLMDAVYVSMKKLGYPDVDIIVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035049`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035049

Location Chr08:12320250-12323342 (+)

Description Similar to GLC1: Glucan endo-1,3-beta-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release
`At4g14080`	Probable beta-1,3-glucanase that may be involved in the degradation of callose walls around the microspore tetrad during pollen development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035049 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT4G14080

ath:AT4G29360

ath:AT4G34480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.576

Rank 1 · LXL04_035049 · OH-1004

Cell membrane0.194

Rank 2 · LXL04_035049 · OH-1004

Endoplasmic reticulum0.099

Rank 3 · LXL04_035049 · OH-1004

Cytoplasm0.081

Rank 4 · LXL04_035049 · OH-1004

Lysosome / Vacuole0.048

Rank 5 · LXL04_035049 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1727-340 aa

PF29664.1BtgE-BtgC_glyc-hydro238-321 aa

PF07983.19X8375-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035049	`PF00332.25`	Glyco_hydro_17	27	340	3.9e-72	244.2
LXL04_035049	`PF29664.1`	BtgE-BtgC_glyc-hydro	238	321	2.8e-07	30.7
LXL04_035049	`PF07983.19`	X8	375	444	2.2e-20	73.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M069`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 7	43.167%	Swiss-Prot	moderate database homology
`Q8VYE5`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 12	37.657%	Swiss-Prot	moderate database homology
`Q06915`	Arabidopsis thaliana	Probable glucan endo-1,3-beta-glucosidase A6	35.068%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card