LXL04_034842 | RubberDandelionOmics

Gene overview

LXL04_034842

Reference: OH-1004 Chr: Chr08 Coordinates: 3987902-3990036 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

999 bp · LXL04_034842|LXL04_034842|OH1004|cDNA

atgTATAATGCGTACATTGATGGTCTGATGAAGGGAAGAAATTCACAAAAAGAAAACGGTACCATTTTCCTAGCTGGCCCACCACTCGTGAAGATTACAGGATACTCAAAATCCCTTGTATTTGCTCAGTTAAAATGTCACAAAAAGTTCAGCAGGCTAAATTCCTGTTGTGGTGGATACAATGTTATTGTCGCCACATCAATTGGAGAAGAAGGTTTAGTCATCATGGAAGTGGATCTTGCATGGGCAGAAGCGGTAGA...

CDS

Download CDS FASTA

999 bp · LXL04_034842|LXL04_034842|OH1004|CDS

ATGTATAATGCGTACATTGATGGTCTGATGAAGGGAAGAAATTCACAAAAAGAAAACGGTACCATTTTCCTAGCTGGCCCACCACTCGTGAAGATTACAGGATACTCAAAATCCCTTGTATTTGCTCAGTTAAAATGTCACAAAAAGTTCAGCAGGCTAAATTCCTGTTGTGGTGGATACAATGTTATTGTCGCCACATCAATTGGAGAAGAAGGTTTAGTCATCATGGAAGTGGATCTTGCATGGGCAGAAGCGGTAGA...

Protein

Download Protein FASTA

332 aa · LXL04_034842|LXL04_034842|OH1004|PROTEIN

MYNAYIDGLMKGRNSQKENGTIFLAGPPLVKITGYSKSLVFAQLKCHKKFSRLNSCCGGYNVIVATSIGEEGLVIMEVDLAWAEAVEKTKAKWISLTHILVLACEGAELDGYRKKQASGKAIKTRMLNGGTNSFRFHPSPRMTDLLAKYFQSSSENDWRPSLIAFPHFQAFPSRVHKVAHSVIQCIICKNCPPIIRGDLALIGSIRGVELLIFPSNQLPEKRLNFSLRKEKEFIAPKNCIPQVALPEKVPQADDVCLPGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034842`
TK1151 ID	TkA04G203020
OH-1004 ID	LXL04_034842
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	95.300
Protein coverage (%)	TK1151 100.000 / OH-1004 77.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034842

Location Chr08:3987902-3990036 (-)

Description Similar to FANCM: DEAD-box ATP-dependent RNA helicase FANCM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35530`	Involved in ordered homologous recombination (HR) events in somatic and meiotic cells.	The Fanconi anemia ortholog FANCM ensures ordered homologous recombination in both somatic and meiotic cells in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096644 FANCM limits meiotic crossovers.2012 · DOI: 10.1126/science.1220381 The requirement for recombination factors differs considerably between different pathways of homologous double-strand break repair in somatic plant cells.2012 · DOI: 10.1111/j.1365-313x.2012.05119.x MHF1 plays Fanconi anaemia complementation group M protein (FANCM)-dependent and FANCM-independent roles in DNA repair and homologous recombination in plants.2014 · DOI: 10.1111/tpj.12507 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.2014 · DOI: 10.1093/nar/gku614 AAA-ATPase FIDGETIN-LIKE 1 and Helicase FANCM Antagonize Meiotic Crossovers by Distinct Mechanisms.2015 · DOI: 10.1371/journal.pgen.1005369

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034842 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0045128 negative regulation of reciprocal meiotic recombination Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0000400 four-way junction DNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009378 four-way junction helicase activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0043138 3'-5' DNA helicase activity Molecular Function

KEGG gene cross-reference

ath:AT1G35530

ssl:SS1G_04065

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.374

Rank 1 · LXL04_034842 · OH-1004

Nucleus0.372

Rank 2 · LXL04_034842 · OH-1004

Mitochondrion0.151

Rank 3 · LXL04_034842 · OH-1004

Cell membrane0.097

Rank 4 · LXL04_034842 · OH-1004

Endoplasmic reticulum0.087

Rank 5 · LXL04_034842 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`I3XHK1`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase FANCM	43.017%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card