LXL04_034558 | RubberDandelionOmics

Gene overview

LXL04_034558

Reference: OH-1004 Chr: Chr07 Coordinates: 106044626-106046055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · LXL04_034558|LXL04_034558|OH1004|cDNA

ATGATGAAAAAAGATAGAAGATTGCAAGAGAAATATCAAAAGACTGGAATTCCGaTTAATTATCCATTTGAGGAGGGTCCTTTGAGCCCTCAGTTTCGTGGAGAACATGCTCTCAGACGTTATCCAACTGGAGAGGCACGATGTACGACACCTAAGCGCAAGAAGCTTTGCTTTATTTGTGGCAATTTGGAGCATAATGCAAAACAGTGCAAGCAGGGAAAGGATTGTTTTATATGCCAAAAGTCTGGTCATGGTGCAAA...

CDS

Download CDS FASTA

441 bp · LXL04_034558|LXL04_034558|OH1004|CDS

ATGATGAAAAAAGATAGAAGATTGCAAGAGAAATATCAAAAGACTGGAATTCCGATTAATTATCCATTTGAGGAGGGTCCTTTGAGCCCTCAGTTTCGTGGAGAACATGCTCTCAGACGTTATCCAACTGGAGAGGCACGATGTACGACACCTAAGCGCAAGAAGCTTTGCTTTATTTGTGGCAATTTGGAGCATAATGCAAAACAGTGCAAGCAGGGAAAGGATTGTTTTATATGCCAAAAGTCTGGTCATGGTGCAAA...

Protein

Download Protein FASTA

146 aa · LXL04_034558|LXL04_034558|OH1004|PROTEIN

MMKKDRRLQEKYQKTGIPINYPFEEGPLSPQFRGEHALRRYPTGEARCTTPKRKKLCFICGNLEHNAKQCKQGKDCFICQKSGHGAKNGPEETTKGMCVLLNATTLFISLFYPMRLVNMSTIIAKGRRHDVNEKVEVKEMLDFKLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034558`
TK1151 ID	TkA06G030650
OH-1004 ID	LXL04_034558
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.194 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034558

Location Chr07:106044626-106046055 (-)

Description Similar to At1g79010: NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79010`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release
`At1g16700`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function

KEGG gene cross-reference

ath:AT1G16700

ath:AT1G79010

mmu:225887

pla:Plav_3218

sot:102589342

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.397

Rank 1 · LXL04_034558 · OH-1004

Nucleus0.337

Rank 2 · LXL04_034558 · OH-1004

Mitochondrion0.201

Rank 3 · LXL04_034558 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_034558 · OH-1004

Extracellular0.056

Rank 5 · LXL04_034558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42599`	Arabidopsis thaliana	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial	77.778%	Swiss-Prot	weak database homology
`Q9FX83`	Arabidopsis thaliana	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial	77.778%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card