LXL04_034457 | RubberDandelionOmics

Gene overview

LXL04_034457

Reference: OH-1004 Chr: Chr07 Coordinates: 101537705-101540641 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · LXL04_034457|LXL04_034457|OH1004|cDNA

ATGGCTACTCTGAGTACCCTTGAACTCATGCTTCATGAAATCCAAAACCAAGAAAATACTGGTGATCATGGGAGGATGCCAGTGTTGCCTCAACGTCCGGTCTCAAAGGCTCGGATACCGTCTAGAAGAACTAGAAGGGCAATCTTGTCATTTCACTTGCATGAATTTGGTGGCAAGAATGAGTTTGTTGATGTCAAGAGCAAAGGAGAAAGATTTGCATTTGTTGATGATGGCGGCCTTGTTCTTAGTAAGAACAATGA...

CDS

Download CDS FASTA

1125 bp · LXL04_034457|LXL04_034457|OH1004|CDS

ATGGCTACTCTGAGTACCCTTGAACTCATGCTTCATGAAATCCAAAACCAAGAAAATACTGGTGATCATGGGAGGATGCCAGTGTTGCCTCAACGTCCGGTCTCAAAGGCTCGGATACCGTCTAGAAGAACTAGAAGGGCAATCTTGTCATTTCACTTGCATGAATTTGGTGGCAAGAATGAGTTTGTTGATGTCAAGAGCAAAGGAGAAAGATTTGCATTTGTTGATGATGGCGGCCTTGTTCTTAGTAAGAACAATGA...

Protein

Download Protein FASTA

374 aa · LXL04_034457|LXL04_034457|OH1004|PROTEIN

MATLSTLELMLHEIQNQENTGDHGRMPVLPQRPVSKARIPSRRTRRAILSFHLHEFGGKNEFVDVKSKGERFAFVDDGGLVLSKNNEDEKEKAVLQIQKCFRRYQARFLYYKLKEGIITLQSFVRGENARRELRKWTKVPTQMHVNQEFVWKPLRNRETAIIYLQSVVRDWLSRKNTNYIQNAPTETKNDANNLHNDDMENEEHVMVSEPYICDLQRQVMRTEAALRHKKRENSILALQIQQIDAKWELHKAEMSSKEKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034457`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034457

Location Chr07:101537705-101540641 (-)

Description Similar to VIII-2: Myosin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54280`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g50360`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At4g27370`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At3g19960`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034457 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT1G50360

ath:AT3G19960

ath:AT4G27370

ath:AT5G54280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_034457 · OH-1004

Nucleus0.284

Rank 2 · LXL04_034457 · OH-1004

Cell membrane0.113

Rank 3 · LXL04_034457 · OH-1004

Mitochondrion0.080

Rank 4 · LXL04_034457 · OH-1004

Golgi apparatus0.066

Rank 5 · LXL04_034457 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K0A6`	Arabidopsis thaliana	Myosin-2	32.692%	Swiss-Prot	moderate database homology
`F4I507`	Arabidopsis thaliana	Myosin-3	31.330%	Swiss-Prot	moderate database homology
`F4JIU4`	Arabidopsis thaliana	Myosin-4	28.859%	Swiss-Prot	weak database homology
`Q9LHE9`	Arabidopsis thaliana	Myosin-1	30.736%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card