LXL04_034450 | RubberDandelionOmics

Gene overview

LXL04_034450

Reference: OH-1004 Chr: Chr07 Coordinates: 101098784-101111133 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5939 bp · LXL04_034450|LXL04_034450|OH1004|cDNA

ATGCCCTCTTTCAGATTGTTCGTAAGCAGTGACGATCACACGATTAATCATTTTATCACACCCCTTATACAATCGGAGCCACTTTCAAAATGGGGCCAATCTGTGTTTATAAGGTGGACTTCGACTGTGGAAGTGAGGTCACTCCCGCGACGCTTTCGTTTCCATGCAAACGATCACGTAATTTCACCAATTGCTCTGTGGGATTCCGCGGATTAGTAGCACAATCCGTTTTGCTGTGTGAGAAATTTGTACAATGGGAT...

CDS

Download CDS FASTA

5850 bp · LXL04_034450|LXL04_034450|OH1004|CDS

ATGGGGCCAATCTGTGTTTATAAGGTGGACTTCGACTGTGGAAGTGAGGTCACTCCCGCGACGCTTTCGTTTCCATGCAAACGATCACGTAATTTCACCAATTGCTCTGTGGGATTCCGCGGATTAGTAGCACAATCCGTTTTGCTGTGTGAGAAATTTGTACAATGGGATTTGAGCCACTGGTTTGGTTTTGCCGGCCGGAGGAAAATGGCATTTGGGCAAAAACAACCGCGAGTGCTCTTGGTGCTTATACACCATGT...

Protein

Download Protein FASTA

1949 aa · LXL04_034450|LXL04_034450|OH1004|PROTEIN

MGPICVYKVDFDCGSEVTPATLSFPCKRSRNFTNCSVGFRGLVAQSVLLCEKFVQWDLSHWFGFAGRRKMAFGQKQPRVLLVLIHHVASNQLVQRFCLRSKRYNYILAILAGYCASESLYRLLFDVSMFDFDAQSSLAPFEVVSLFLETLVWSCLVIMTLLETKVYIREFRWYVRFGVLYVLVGDTVKLSLILSVKDLYPSSVLYLYISSLLCQALFGALIVAYVPNLDTYMGYIPLQSDPVDDIIKYEMLRGGEHICPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034450`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034450

Location Chr07:101098784-101111133 (-)

Description Similar to ABCC12: ABC transporter C family member 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30410`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At1g30420`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At2g34660`	Pump for glutathione S-conjugates.	Enhanced multispecificity of arabidopsis vacuolar multidrug resistance-associated protein-type ATP-binding cassette transporter, AtMRP2.2001 · DOI: 10.1074/jbc.m009690200 AtMRP2, an Arabidopsis ATP binding cassette transporter able to transport glutathione S-conjugates and chlorophyll catabolites: functional comparisons with Atmrp1.1998 · DOI: 10.1105/tpc.10.2.267
`At1g30400`	Pump for glutathione S-conjugates.	AtMRP1 gene of Arabidopsis encodes a glutathione S-conjugate pump: isolation and functional definition of a plant ATP-binding cassette transporter gene.1997 · DOI: 10.1073/pnas.94.15.8243

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034450 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0015700 arsenite transport Biological Process

GO:0034775 glutathione transmembrane transport Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0070729 cyclic nucleotide transport Biological Process

GO:1902418 (+)-abscisic acid D-glucopyranosyl ester transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G30400

ath:AT1G30410

ath:AT1G30420

ath:AT2G34660

gga:395416

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.313

Rank 1 · LXL04_034450 · OH-1004

Lysosome / Vacuole0.251

Rank 2 · LXL04_034450 · OH-1004

Endoplasmic reticulum0.248

Rank 3 · LXL04_034450 · OH-1004

Cytoplasm0.146

Rank 4 · LXL04_034450 · OH-1004

Golgi apparatus0.115

Rank 5 · LXL04_034450 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane349-594 aa

PF00005.34ABC_tran656-795 aa

PF00664.29ABC_membrane941-1191 aa

PF00005.34ABC_tran1278-1426 aa

PF14291.12DUF43711653-1777 aa

PF14291.12DUF43711774-1808 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034450	`PF00664.29`	ABC_membrane	349	594	9.2e-63	213.2
LXL04_034450	`PF00005.34`	ABC_tran	656	795	1.7e-47	162.2
LXL04_034450	`PF00664.29`	ABC_membrane	941	1191	9.2e-63	213.2
LXL04_034450	`PF00005.34`	ABC_tran	1278	1426	1.7e-47	162.2
LXL04_034450	`PF14291.12`	DUF4371	1653	1777	1.2e-57	195.9
LXL04_034450	`PF14291.12`	DUF4371	1774	1808	1.2e-57	195.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8H0`	Arabidopsis thaliana	ABC transporter C family member 12	70.014%	Swiss-Prot	strong database homology
`Q9C8H1`	Arabidopsis thaliana	ABC transporter C family member 11	67.807%	Swiss-Prot	strong database homology
`Q42093`	Arabidopsis thaliana	ABC transporter C family member 2	67.104%	Swiss-Prot	strong database homology
`Q9C8G9`	Arabidopsis thaliana	ABC transporter C family member 1	64.422%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card