LXL04_034369 | RubberDandelionOmics

Gene overview

LXL04_034369

Reference: OH-1004 Chr: Chr07 Coordinates: 98007535-98008814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_034369|LXL04_034369|OH1004|cDNA

ATGGTTACAAAGTCAATCCGACACGTTGTCAAGTGTTCCAAGAATCAAAGTTCCCGACAACTAATCAAGCTAAATGTTGCGGAAGCCAAAATTGCGAAAAAGGCAAGCAAGACAGAACACCATTTATGGAATAAGAGAGATTCTGCTGCATCTGGGCAAAAAGCATTGAATCTTGTTCGGATAGTTTGTGGGTTGCCAAATGAGAAAGAAGCAGTGTATGGAGCACTTGATAAATGGACAGCATGGGAGTCAGAGTTCCC...

CDS

Download CDS FASTA

732 bp · LXL04_034369|LXL04_034369|OH1004|CDS

ATGGTTACAAAGTCAATCCGACACGTTGTCAAGTGTTCCAAGAATCAAAGTTCCCGACAACTAATCAAGCTAAATGTTGCGGAAGCCAAAATTGCGAAAAAGGCAAGCAAGACAGAACACCATTTATGGAATAAGAGAGATTCTGCTGCATCTGGGCAAAAAGCATTGAATCTTGTTCGGATAGTTTGTGGGTTGCCAAATGAGAAAGAAGCAGTGTATGGAGCACTTGATAAATGGACAGCATGGGAGTCAGAGTTCCC...

Protein

Download Protein FASTA

243 aa · LXL04_034369|LXL04_034369|OH1004|PROTEIN

MVTKSIRHVVKCSKNQSSRQLIKLNVAEAKIAKKASKTEHHLWNKRDSAASGQKALNLVRIVCGLPNEKEAVYGALDKWTAWESEFPVIAVAKALNILKQRKQWTRVIQVAKWMFGKGQGMTMGTFDTLIHAFDMEERVDEAESFWNMILHTHQRSISKRLFSRIIAMYAHHHMPQNIIEVFADMEELGVRPDEDTVRKVARAFKKVGEKEKQELVLRKYLTPYKYIHFKGERVRVTRYAPTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034369`
TK1151 ID	TkAUNG071520
OH-1004 ID	LXL04_034369
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	66.200
Protein coverage (%)	TK1151 97.183 / OH-1004 85.185 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034369

Location Chr07:98007535-98008814 (+)

Description Similar to At4g18975: Pentatricopeptide repeat-containing protein At4g18975, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18975`	Pentatricopeptide repeat-containing protein At4g18975, chloroplastic.	No verified direct reference in this release
`At4g21190`	Pentatricopeptide repeat-containing protein At4g21190.	No verified direct reference in this release
`At3g04130`	Pentatricopeptide repeat-containing protein At3g04130, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034369 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G04130

ath:AT4G18975

ath:AT4G21190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.792

Rank 1 · LXL04_034369 · OH-1004

Plastid0.144

Rank 2 · LXL04_034369 · OH-1004

Nucleus0.060

Rank 3 · LXL04_034369 · OH-1004

Cytoplasm0.035

Rank 4 · LXL04_034369 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_034369 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2164-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034369	`PF13041.13`	PPR_2	164	199	3.4e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V3H0`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g18975, chloroplastic	68.720%	Swiss-Prot	strong database homology
`Q8LG95`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g21190	43.147%	Swiss-Prot	moderate database homology
`Q9M8W9`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g04130, mitochondrial	25.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card