LXL04_034345 | RubberDandelionOmics

Gene overview

LXL04_034345

Reference: OH-1004 Chr: Chr07 Coordinates: 97261816-97262652 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · LXL04_034345|LXL04_034345|OH1004|cDNA

ATGGCTCTTTTGCCTGTGTTTTCATGCTTCCTCCTTTGGTCGTTGGTTTCCACAGCAACCGCATTTGACATTACAAAAATCCTTGATCAGTACTCTGACTACGATACATTCAATCAGGAGCTCTCTAAGACTGGAGTGGCCGAAGAGATCAACCAGCGCAAGTCAGTCACGATCTTGGTCGTCTGTAATGACGCAATGTCTGCTGTCACCAGCCAAAAAGAAGGCTCAATTGCTGATATCATGAGGATTCATGTCGTTCT...

CDS

Download CDS FASTA

837 bp · LXL04_034345|LXL04_034345|OH1004|CDS

ATGGCTCTTTTGCCTGTGTTTTCATGCTTCCTCCTTTGGTCGTTGGTTTCCACAGCAACCGCATTTGACATTACAAAAATCCTTGATCAGTACTCTGACTACGATACATTCAATCAGGAGCTCTCTAAGACTGGAGTGGCCGAAGAGATCAACCAGCGCAAGTCAGTCACGATCTTGGTCGTCTGTAATGACGCAATGTCTGCTGTCACCAGCCAAAAAGAAGGCTCAATTGCTGATATCATGAGGATTCATGTCGTTCT...

Protein

Download Protein FASTA

278 aa · LXL04_034345|LXL04_034345|OH1004|PROTEIN

MALLPVFSCFLLWSLVSTATAFDITKILDQYSDYDTFNQELSKTGVAEEINQRKSVTILVVCNDAMSAVTSQKEGSIADIMRIHVVLDYYDSAKIRTLKDETTLTTLYQTTGSAKKEQGFIIVSKNDNEIKLGSAVSGSQMSAKLNKVVTSVPYDVSIIEISSPIIPSGINDSGSDQPSKSSPAESPNNSSSSSPSESPADSSSGDTAAQAPAPSPSDADAPSGGVDSSADDADADGDVYATDANAPSGVADADQNSSSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034345`
TK1151 ID	TkA08G008890
OH-1004 ID	LXL04_034345
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034345

Location Chr07:97261816-97262652 (+)

Description Similar to FLA3: Fasciclin-like arabinogalactan protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24450`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g12660`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At4g31370`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g45470`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g60900`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034345 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G24450

ath:AT2G45470

ath:AT3G12660

ath:AT3G60900

ath:AT4G31370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.479

Rank 1 · LXL04_034345 · OH-1004

Extracellular0.259

Rank 2 · LXL04_034345 · OH-1004

Endoplasmic reticulum0.142

Rank 3 · LXL04_034345 · OH-1004

Cytoplasm0.097

Rank 4 · LXL04_034345 · OH-1004

Lysosome / Vacuole0.060

Rank 5 · LXL04_034345 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469.28Fasciclin33-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034345	`PF02469.28`	Fasciclin	33	124	4.9e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ23`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 3	30.357%	Swiss-Prot	moderate database homology
`Q9LTW9`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 14	39.785%	Swiss-Prot	moderate database homology
`O49586`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 5	33.585%	Swiss-Prot	moderate database homology
`O22126`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 8	42.683%	Swiss-Prot	moderate database homology
`Q9LZX4`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 10	40.123%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card