Gene Card
Gene overview
cDNA / CDS / Protein Sequences
708 bp · LXL04_034339|LXL04_034339|OH1004|cDNA
ATGCAAAAACTTGCGAAGGAATTGGGAGTTGTTATACCTGTATACAACTCAATAGCCATAATTGATGTTGATGGAACTGATCTTGGATTTATAGAAAATCTCACATCCCAGATGGACCAGGAAATGAGGAGAAGTTCTACTTCAATCCAGGTGTTCCAAACTAAGTTTGCTAAGATAGGCGTGGCAATATGTTGGGACCAATGGTTTCCGGAAACTGCAAGAGCCATGGTTCTTCAAAGTGCAGAATTACTATTTTACCC...
708 bp · LXL04_034339|LXL04_034339|OH1004|CDS
ATGCAAAAACTTGCGAAGGAATTGGGAGTTGTTATACCTGTATACAACTCAATAGCCATAATTGATGTTGATGGAACTGATCTTGGATTTATAGAAAATCTCACATCCCAGATGGACCAGGAAATGAGGAGAAGTTCTACTTCAATCCAGGTGTTCCAAACTAAGTTTGCTAAGATAGGCGTGGCAATATGTTGGGACCAATGGTTTCCGGAAACTGCAAGAGCCATGGTTCTTCAAAGTGCAGAATTACTATTTTACCC...
Protein
Download Protein FASTA235 aa · LXL04_034339|LXL04_034339|OH1004|PROTEIN
MQKLAKELGVVIPVYNSIAIIDVDGTDLGFIENLTSQMDQEMRRSSTSIQVFQTKFAKIGVAICWDQWFPETARAMVLQSAELLFYPTAIGSEPQDQGLDSRDHWKCIMEGHAGASLVPLIASNRIGNEVIKTEHGDSSITFYGNSFIAGPTGETITCANDKEEAMLLAKLYSISNYQIVYIQPVRAFICHRLTSHYIWNICGSWVRVQNYRHAPPESVFMNDKAHVDAVNICKP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_034339 |
|---|---|
| TK1151 ID | TkA05G068760 |
| OH-1004 ID | LXL04_034339 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 81.500 |
| Protein coverage (%) | TK1151 93.182 / OH-1004 84.681Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_034339 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:96878866-96880073 (+) | ||||||||||||
| Description | Similar to CPA: N-carbamoylputrescine amidase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0009446 putrescine biosynthetic process Biological Process GO:0033388 putrescine biosynthetic process from arginine Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0047781 citrullinase activity Molecular Function GO:0050126 N-carbamoylputrescine amidase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G27450 dosa:Os02g0533900 ftu:FTT_0435 sly:544141 sot:102600318 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00795.28CN_hydrolase38-171 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_034339 | PF00795.28 | CN_hydrolase | 38 | 171 | 9.9e-24 | 84.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.