RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_034292
Reference: OH-1004 Chr: Chr07 Coordinates: 94864505-94867752 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2163 bp · LXL04_034292|LXL04_034292|OH1004|cDNA

ATGAGCAAAGTCCTGGTCGGCATATTGAAGTCCGTGGAAGCAAAACTCAAAAAATCACAAACATCCGCTAAAAAAAGGGCAATCCGAATTTTCACAACAATGTCTGTCGCCCACGTGGATGACGACGACAGCGATGCAGAAGTTTACAACACCGAGAAGCTCTTCTGTAATGGCGACATCTATATCGGTCAGTGGGCCACCGACACCCCTCATGGAAACGGCAAATACTTATGGTCCGATGGGTGTATGTACTTAGGCGA...

CDS

Download CDS FASTA

2163 bp · LXL04_034292|LXL04_034292|OH1004|CDS

ATGAGCAAAGTCCTGGTCGGCATATTGAAGTCCGTGGAAGCAAAACTCAAAAAATCACAAACATCCGCTAAAAAAAGGGCAATCCGAATTTTCACAACAATGTCTGTCGCCCACGTGGATGACGACGACAGCGATGCAGAAGTTTACAACACCGAGAAGCTCTTCTGTAATGGCGACATCTATATCGGTCAGTGGGCCACCGACACCCCTCATGGAAACGGCAAATACTTATGGTCCGATGGGTGTATGTACTTAGGCGA...

Protein

Download Protein FASTA

720 aa · LXL04_034292|LXL04_034292|OH1004|PROTEIN

MSKVLVGILKSVEAKLKKSQTSAKKRAIRIFTTMSVAHVDDDDSDAEVYNTEKLFCNGDIYIGQWATDTPHGNGKYLWSDGCMYLGDWNNGKIQGKGKFSWPSGATYEGDFKNGFMDGEGTFTGSVNDTYKGSWVMNNKQGKGIRNCVNGDHYDGEWKRGFHNGQGRYHWENGHQYIGQWKNGKMNGNGTMMWANGNRYDGSWEDGLPKGNGTFHWLDGSFYAGIWSRDQKEQSGKFYPATSDVPHDDWDPNQLFSVEMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_034292
TK1151 IDTkA07G077870
OH-1004 IDLXL04_034292
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)67.900
Protein coverage (%)TK1151 100.000 / OH-1004 99.444
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_034292
LocationChr07:94864505-94867752 (+)
DescriptionSimilar to PIP5K6: Phosphatidylinositol 4-phosphate 5-kinase 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g07960 Phosphatidylinositol 4-phosphate 5-kinase 6. No verified direct reference in this release
At3g56960 Phosphatidylinositol 4-phosphate 5-kinase 4. No verified direct reference in this release
At2g41210 Phosphatidylinositol 4-phosphate 5-kinase 5. No verified direct reference in this release
At1g77740 Possesses phosphatidylinositol (PtdIns) phosphate kinase activity (Probable).
Arabidopsis Rab-E GTPases exhibit a novel interaction with a plasma-membrane phosphatidylinositol-4-phosphate 5-kinase.2009 · DOI: 10.1242/jcs.053488
At1g21980 Catalyzes the synthesis of phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4-bisphosphate.
AtPIP5K1, an Arabidopsis thaliana phosphatidylinositol phosphate kinase, synthesizes PtdIns(3,4)P(2) and PtdIns(4,5)P(2) in vitro and is inhibited by phosphorylation.2001 · DOI: 10.1042/0264-6021:3590583

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_034292 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0003006 developmental process involved in reproduction Biological Process
GO:0006897 endocytosis Biological Process
GO:0007164 establishment of tissue polarity Biological Process
GO:0009827 plant-type cell wall modification Biological Process
GO:0009846 pollen germination Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0009958 positive gravitropism Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010311 lateral root formation Biological Process
GO:0046488 phosphatidylinositol metabolic process Biological Process
GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process
GO:0072583 clathrin-dependent endocytosis Biological Process
KEGG gene cross-reference
ath:AT1G21980
ath:AT1G77740
ath:AT2G41210
ath:AT3G07960
ath:AT3G56960
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.414
Rank 1 · LXL04_034292 · OH-1004
Cytoplasm0.401
Rank 2 · LXL04_034292 · OH-1004
Nucleus0.232
Rank 3 · LXL04_034292 · OH-1004
Golgi apparatus0.067
Rank 4 · LXL04_034292 · OH-1004
Endoplasmic reticulum0.066
Rank 5 · LXL04_034292 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02493.27MORN61-83 aa
PF02493.27MORN84-105 aa
PF02493.27MORN107-126 aa
PF02493.27MORN153-174 aa
PF02493.27MORN176-198 aa
PF02493.27MORN199-220 aa
PF01504.25PIP5K425-714 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_034292PF02493.27MORN61831.5e-36122.8
LXL04_034292PF02493.27MORN841051.5e-36122.8
LXL04_034292PF02493.27MORN1071261.5e-36122.8
LXL04_034292PF02493.27MORN1531741.5e-36122.8
LXL04_034292PF02493.27MORN1761981.5e-36122.8
LXL04_034292PF02493.27MORN1992201.5e-36122.8
LXL04_034292PF01504.25PIP5K4257143.8e-99332.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SFB8Arabidopsis thalianaPhosphatidylinositol 4-phosphate 5-kinase 663.209%Swiss-Protstrong database homology
Q9M1K2Arabidopsis thalianaPhosphatidylinositol 4-phosphate 5-kinase 457.270%Swiss-Protstrong database homology
Q9SLG9Arabidopsis thalianaPhosphatidylinositol 4-phosphate 5-kinase 556.371%Swiss-Protstrong database homology
Q8L796Arabidopsis thalianaPhosphatidylinositol 4-phosphate 5-kinase 250.142%Swiss-Protstrong database homology
Q56YP2Arabidopsis thalianaPhosphatidylinositol 4-phosphate 5-kinase 150.565%Swiss-Protstrong database homology

JBrowse

View in Genome Browser