LXL04_034243 | RubberDandelionOmics

Gene overview

LXL04_034243

Reference: OH-1004 Chr: Chr07 Coordinates: 92917709-92918964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_034243|LXL04_034243|OH1004|cDNA

ATGTTGGGTATCTTCAAGAATGGCTTGGTGAGTGCTCCAAAAGAGCTCAATAGTCCTTCACGAGATCAACACCATCATCATCAGAATCAAGATCCTTTGAAGCATTTCTTGAATTCCAATCCCAATGCTTTCTCCTTTTCTTTTGGAACTGATGCTTCTTTGGCATTTCACACTTCTTCTTCTACCAGTTCATCAAAACAAAGGTTGTTTAGTAGCATGGATGACATCTATTGCATATTTTTGGGTGGTCTAGACAACTT...

CDS

Download CDS FASTA

762 bp · LXL04_034243|LXL04_034243|OH1004|CDS

ATGTTGGGTATCTTCAAGAATGGCTTGGTGAGTGCTCCAAAAGAGCTCAATAGTCCTTCACGAGATCAACACCATCATCATCAGAATCAAGATCCTTTGAAGCATTTCTTGAATTCCAATCCCAATGCTTTCTCCTTTTCTTTTGGAACTGATGCTTCTTTGGCATTTCACACTTCTTCTTCTACCAGTTCATCAAAACAAAGGTTGTTTAGTAGCATGGATGACATCTATTGCATATTTTTGGGTGGTCTAGACAACTT...

Protein

Download Protein FASTA

253 aa · LXL04_034243|LXL04_034243|OH1004|PROTEIN

MLGIFKNGLVSAPKELNSPSRDQHHHHQNQDPLKHFLNSNPNAFSFSFGTDASLAFHTSSSTSSSKQRLFSSMDDIYCIFLGGLDNLCSLNKQYGLTKISNEPMFVIQAYKTLRDRGPYPAHSVLKELEGTFGFILYDLKAKTVFVSLGADGGVKLYWGIAADGSVVISDNLVAIKSSCSKSFAPFPTGCMYHTEGGLMSFEHPKNKMKAISRVDSEGVMCGASFKVDVYSKTTQTMTRVGSEANWATWGQGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034243`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034243

Location Chr07:92917709-92918964 (+)

Description Similar to TSJT1: Stem-specific protein TSJT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0291500`	Essential for nitrogen assimilation, distribution and remobilization within the plant via the phloem.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0070981 L-asparagine biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0004066 asparagine synthase (glutamine-hydrolyzing) activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ddi:DDB_G0286059

dosa:Os03g0291500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · LXL04_034243 · OH-1004

Nucleus0.413

Rank 2 · LXL04_034243 · OH-1004

Cell membrane0.110

Rank 3 · LXL04_034243 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_034243 · OH-1004

Lysosome / Vacuole0.074

Rank 5 · LXL04_034243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12481.14DUF37002-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034243	`PF12481.14`	DUF3700	2	227	7e-96	320.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10MX3`	Oryza sativa subsp. japonica	Asparagine synthetase [glutamine-hydrolyzing] 1	37.975%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card