LXL04_034149 | RubberDandelionOmics

Gene overview

LXL04_034149

Reference: OH-1004 Chr: Chr07 Coordinates: 85676970-85693627 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2814 bp · LXL04_034149|LXL04_034149|OH1004|cDNA

ATGGTGGAGGACTTGTGGAATAATGATGACATTCTTGAACTAAATGCTATTATTCGCCTCAAAAAGAATATTCAGGCCTTTAAAGTGAAGTTGAAGTCTTGGAACGGTTCTTTGCGCCAATGTCGGGAAGCTGATCGGGTATGGTTGCAAACGGAGTTGGTGGATATTGAGATCCAGTTGGACGAGGGTTTGGTTCCCGATCCCTCCCTTAACTCTTGGTTCTCTATTGTTAAACAAATTTCGAATATTAATCGTGTTGC...

CDS

Download CDS FASTA

2814 bp · LXL04_034149|LXL04_034149|OH1004|CDS

ATGGTGGAGGACTTGTGGAATAATGATGACATTCTTGAACTAAATGCTATTATTCGCCTCAAAAAGAATATTCAGGCCTTTAAAGTGAAGTTGAAGTCTTGGAACGGTTCTTTGCGCCAATGTCGGGAAGCTGATCGGGTATGGTTGCAAACGGAGTTGGTGGATATTGAGATCCAGTTGGACGAGGGTTTGGTTCCCGATCCCTCCCTTAACTCTTGGTTCTCTATTGTTAAACAAATTTCGAATATTAATCGTGTTGC...

Protein

Download Protein FASTA

937 aa · LXL04_034149|LXL04_034149|OH1004|PROTEIN

MVEDLWNNDDILELNAIIRLKKNIQAFKVKLKSWNGSLRQCREADRVWLQTELVDIEIQLDEGLVPDPSLNSWFSIVKQISNINRVASLDAAQKDKVKWAMEGYGNSSFFHDPDRLKREFLFHFSDRFAKPTPFRASIVSEFLSQLTDQHHLDLETTASCKKAMVFKVDFEKAYDTLRWDFLDDVLLAFGFGPNWRSWIRGCLVSSMGSAMKAKTLSVGGRLTQVKAVLGALPTYFFSIYKAPMAVLSQTESLWNNVFLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034149`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034149

Location Chr07:85676970-85693627 (-)

Description Similar to SCPL40: Serine carboxypeptidase-like 40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63470`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g52020`	Probable carboxypeptidase.	No verified direct reference in this release
`At4g30610`	Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups.	BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.091065998 Arabidopsis BRS1 is a secreted and active serine carboxypeptidase.2005 · DOI: 10.1074/jbc.m503299200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034149 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G52020

ath:AT3G63470

ath:AT4G30610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.224

Rank 1 · LXL04_034149 · OH-1004

Endoplasmic reticulum0.210

Rank 2 · LXL04_034149 · OH-1004

Cytoplasm0.174

Rank 3 · LXL04_034149 · OH-1004

Plastid0.102

Rank 4 · LXL04_034149 · OH-1004

Cell membrane0.096

Rank 5 · LXL04_034149 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S10519-928 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034149	`PF00450.29`	Peptidase_S10	519	928	9.1e-139	464.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRX3`	Arabidopsis thaliana	Serine carboxypeptidase-like 40	60.291%	Swiss-Prot	moderate database homology
`Q9SV02`	Arabidopsis thaliana	Serine carboxypeptidase-like 39	48.708%	Swiss-Prot	moderate database homology
`Q9M099`	Arabidopsis thaliana	Serine carboxypeptidase 24	51.818%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card