LXL04_034141 | RubberDandelionOmics

Gene overview

LXL04_034141

Reference: OH-1004 Chr: Chr07 Coordinates: 84330748-84335231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2055 bp · LXL04_034141|LXL04_034141|OH1004|cDNA

ATGTGTGGGATTTTTGCCTACTTGAATTACGATGTCAGTAGAGAGAGACGCTACATCCTCGAGGTACTCTTTAATGGACTTCGTCGTTTGGAATACAGAGGTTACGATTCAGCGGGGATCTCTATTGATTCTTCCTCCGTCACCGGTTCCGTTAATGCATCATCTGATTCCCCTCTCGTGTTTCGTCAAGAGGGAAACATCGAATCCTTAGTCAAATGTGTCTACCaagAGGTCGCTGCTACTGACCTAAATCTAGAAGC...

CDS

Download CDS FASTA

2055 bp · LXL04_034141|LXL04_034141|OH1004|CDS

ATGTGTGGGATTTTTGCCTACTTGAATTACGATGTCAGTAGAGAGAGACGCTACATCCTCGAGGTACTCTTTAATGGACTTCGTCGTTTGGAATACAGAGGTTACGATTCAGCGGGGATCTCTATTGATTCTTCCTCCGTCACCGGTTCCGTTAATGCATCATCTGATTCCCCTCTCGTGTTTCGTCAAGAGGGAAACATCGAATCCTTAGTCAAATGTGTCTACCAAGAGGTCGCTGCTACTGACCTAAATCTAGAAGC...

Protein

Download Protein FASTA

684 aa · LXL04_034141|LXL04_034141|OH1004|PROTEIN

MCGIFAYLNYDVSRERRYILEVLFNGLRRLEYRGYDSAGISIDSSSVTGSVNASSDSPLVFRQEGNIESLVKCVYQEVAATDLNLEASFSIHAGIAHTRWATHGEPAPRNSHPQSSGAGNDFLVVHNGVITNYEVLKQSLLRHGYTFESETDTEVIPKLAKFVFDKANEEGEQTVTFTEVVLEVMRHLEGAYALIFKSRHYPNELIACKRGSPLLLGVKEFAEQQNNGTSYNDMKFISTNGHPKELFLSSDPHALVEHTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034141`
TK1151 ID	TkA08G366790
OH-1004 ID	LXL04_034141
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034141

Location Chr07:84330748-84335231 (-)

Description Similar to GFPT2: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24090`	Controls the flux of glucose into the hexosamine biosynthetic pathway (HBP) leading to glucosamine (GlcN) content homeostasis.	Deficiency of AtGFAT1 activity impairs growth, pollen germination and tolerance to tunicamycin in Arabidopsis.2019 · DOI: 10.1093/jxb/erz055

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034141 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006047 UDP-N-acetylglucosamine metabolic process Biological Process

GO:0006048 UDP-N-acetylglucosamine biosynthetic process Biological Process

GO:0006112 energy reserve metabolic process Biological Process

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006541 glutamine metabolic process Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0072720 response to dithiothreitol Biological Process

GO:1990830 cellular response to leukemia inhibitory factor Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G24090

bta:530101

hsa:9945

mmu:14584

rno:360518

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.549

Rank 1 · LXL04_034141 · OH-1004

Nucleus0.231

Rank 2 · LXL04_034141 · OH-1004

Mitochondrion0.133

Rank 3 · LXL04_034141 · OH-1004

Peroxisome0.109

Rank 4 · LXL04_034141 · OH-1004

Cell membrane0.077

Rank 5 · LXL04_034141 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13522.13GATase_692-159 aa

PF13537.12GATase_7110-200 aa

PF01380.28SIS365-492 aa

PF01380.28SIS536-666 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034141	`PF13522.13`	GATase_6	92	159	3.8e-11	43.5
LXL04_034141	`PF13537.12`	GATase_7	110	200	1.2e-09	38.9
LXL04_034141	`PF01380.28`	SIS	365	492	8.4e-58	194.5
LXL04_034141	`PF01380.28`	SIS	536	666	8.4e-58	194.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIP9`	Arabidopsis thaliana	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1	80.730%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card