LXL04_033920 | RubberDandelionOmics

Gene overview

LXL04_033920

Reference: OH-1004 Chr: Chr07 Coordinates: 65497736-65502964 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1704 bp · LXL04_033920|LXL04_033920|OH1004|cDNA

ATGTCTTCTCTAATCATGCCATCTTATTCTTGTTCTTCATCCCTTAATTTCCCTCGATCAGGACTTCTAAACCCCCTAAATCGATCGCCTCAACCAGCTACTAATAGCTTTCCTTTTAATCCTCTTTTTTCTTCCCGTTTCTACTTCAAGGCCAAGCTATCGCCATCGAAATTTCAGAAATATGCGCATTCTTCTACGAGGCACAGACATCTTGTTGTTGCTGCCATGGATTGGGACATGTCTAGCTTTTCACTAGATGA...

CDS

Download CDS FASTA

1704 bp · LXL04_033920|LXL04_033920|OH1004|CDS

ATGTCTTCTCTAATCATGCCATCTTATTCTTGTTCTTCATCCCTTAATTTCCCTCGATCAGGACTTCTAAACCCCCTAAATCGATCGCCTCAACCAGCTACTAATAGCTTTCCTTTTAATCCTCTTTTTTCTTCCCGTTTCTACTTCAAGGCCAAGCTATCGCCATCGAAATTTCAGAAATATGCGCATTCTTCTACGAGGCACAGACATCTTGTTGTTGCTGCCATGGATTGGGACATGTCTAGCTTTTCACTAGATGA...

Protein

Download Protein FASTA

568 aa · LXL04_033920|LXL04_033920|OH1004|PROTEIN

MSSLIMPSYSCSSSLNFPRSGLLNPLNRSPQPATNSFPFNPLFSSRFYFKAKLSPSKFQKYAHSSTRHRHLVVAAMDWDMSSFSLDDRADSDGAIGYSFSSSEGEESDGDIVLNPITDVDIPTSREEFHEPDDDDAISAHKIARIGRSRRRNRIKYGIFINIGLVTFLTILLLLLDSHVWRIVRLPLPPFHLICPFMASSILVSCAGYICVPLFRISKMKQIISKWPPRHSSKKGTTTMGGLFLIPIGVIVAEVLVGFSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033920`
TK1151 ID	TkA07G417050
OH-1004 ID	LXL04_033920
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.599 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033920

Location Chr07:65497736-65502964 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18270`	May be involved in glycosylation events.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033920 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008360 regulation of cell shape Biological Process

GO:0044038 cell wall macromolecule biosynthetic process Biological Process

GO:0051301 cell division Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008963 phospho-N-acetylmuramoyl-pentapeptide-transferase activity Molecular Function

GO:0016780 phosphotransferase activity, for other substituted phosphate groups Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051992 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimelyl-D-alanyl-D-alanine:undecaprenyl-phosphate transferase activity Molecular Function

KEGG gene cross-reference

amr:AM1_5787

ath:AT4G18270

cyc:PCC7424_0466

cyp:PCC8801_4365

mar:MAE_00970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · LXL04_033920 · OH-1004

Nucleus0.030

Rank 2 · LXL04_033920 · OH-1004

Mitochondrion0.030

Rank 3 · LXL04_033920 · OH-1004

Cytoplasm0.025

Rank 4 · LXL04_033920 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_033920 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00953.27Glycos_transf_4266-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033920	`PF00953.27`	Glycos_transf_4	266	432	1.6e-25	90.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49730`	Arabidopsis thaliana	Phospho-N-acetylmuramoyl-pentapeptide-transferase homolog	55.666%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card