LXL04_033774 | RubberDandelionOmics

Gene overview

LXL04_033774

Reference: OH-1004 Chr: Chr07 Coordinates: 56777311-56778309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · LXL04_033774|LXL04_033774|OH1004|cDNA

ATGGCGACGTTGACTCCAGGGGTTTTATTGAAGTTACTGGATACGATGAATTCAGGGGTGAAGCCTACAAGCGAACACGGGAGTTCACTTCTACAAGTTACGGATATCATGCCAGCTGATCTAGACGAGAAAGATCTCTGGCCAAAACATGGTAATAAAATCCAGCTTGGCCAATTCATTCATGTCCAAAAACTGGAGTTTGGTTCCCCTGTTCCGATAGCTAAAGGAGTTAAACCACTTCCAGGCCGCCACCCGTTTGT...

CDS

Download CDS FASTA

861 bp · LXL04_033774|LXL04_033774|OH1004|CDS

ATGGCGACGTTGACTCCAGGGGTTTTATTGAAGTTACTGGATACGATGAATTCAGGGGTGAAGCCTACAAGCGAACACGGGAGTTCACTTCTACAAGTTACGGATATCATGCCAGCTGATCTAGACGAGAAAGATCTCTGGCCAAAACATGGTAATAAAATCCAGCTTGGCCAATTCATTCATGTCCAAAAACTGGAGTTTGGTTCCCCTGTTCCGATAGCTAAAGGAGTTAAACCACTTCCAGGCCGCCACCCGTTTGT...

Protein

Download Protein FASTA

286 aa · LXL04_033774|LXL04_033774|OH1004|PROTEIN

MATLTPGVLLKLLDTMNSGVKPTSEHGSSLLQVTDIMPADLDEKDLWPKHGNKIQLGQFIHVQKLEFGSPVPIAKGVKPLPGRHPFVGMPEPLMGLKGKREINHPIGNLHLNSKLSASRRSSWSTKGEHGICESPMSLMSCPLMFDQCTPMKESSSMIRSSIRRASLSKVTETPVTVKKSFVTSSMVKIPKSKGNLCDKGAKMSTSPFNSAVGTCEKDVVSIKSATETPNKEHKHNDSNQKSTILGKHMRSLNVNQKVEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033774`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033774

Location Chr07:56777311-56778309 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23790`	Microtubule-associated protein controlling microtubule network organization (By similarity).	No verified direct reference in this release
`At1g70340`	Microtubule-associated protein controlling microtubule network organization (By similarity).	No verified direct reference in this release
`At4g13370`	Microtubule-associated protein controlling microtubule network organization.	No verified direct reference in this release
`At1g08760`	Microtubule-associated protein required, redundantly with CORD1, for the formation of the pitted secondary cell wall of metaxylem vessels.	CORTICAL MICROTUBULE DISORDERING1 Is Required for Secondary Cell Wall Patterning in Xylem Vessels.2017 · DOI: 10.1105/tpc.17.00663
`At3g14170`	Microtubule-associated protein required, redundantly with CORD2, for the formation of the pitted secondary cell wall of metaxylem vessels.	CORTICAL MICROTUBULE DISORDERING1 Is Required for Secondary Cell Wall Patterning in Xylem Vessels.2017 · DOI: 10.1105/tpc.17.00663

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033774 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0048759 xylem vessel member cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005874 microtubule Cellular Component

GO:0008017 microtubule binding Molecular Function

GO:0043015 gamma-tubulin binding Molecular Function

GO:0060090 molecular adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G08760

ath:AT1G23790

ath:AT1G70340

ath:AT4G13370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · LXL04_033774 · OH-1004

Cytoplasm0.438

Rank 2 · LXL04_033774 · OH-1004

Cell membrane0.093

Rank 3 · LXL04_033774 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_033774 · OH-1004

Mitochondrion0.028

Rank 5 · LXL04_033774 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06075.19CORD_N4-51 aa

PF06075.19CORD_N52-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033774	`PF06075.19`	CORD_N	4	51	1.3e-27	96.7
LXL04_033774	`PF06075.19`	CORD_N	52	94	1.3e-27	96.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUB7`	Arabidopsis thaliana	Protein CORTICAL MICROTUBULE DISORDERING 4	37.273%	Swiss-Prot	moderate database homology
`O64602`	Arabidopsis thaliana	Protein CORTICAL MICROTUBULE DISORDERING 5	38.614%	Swiss-Prot	moderate database homology
`Q9T0K8`	Arabidopsis thaliana	Protein CORTICAL MICROTUBULE DISORDERING 3	47.107%	Swiss-Prot	weak database homology
`Q9FRR2`	Arabidopsis thaliana	Protein CORTICAL MICROTUBULE DISORDERING 2	47.107%	Swiss-Prot	weak database homology
`Q6NKR8`	Arabidopsis thaliana	Protein CORTICAL MICROTUBULE DISORDERING 1	43.443%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card