Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1557 bp · LXL04_033717|LXL04_033717|OH1004|cDNA
ATGTTTTTcgttttatttgtttttgtttacTTATTCAACAACGCACCACCGATCCATTTCTCCCTAAAACCTTTTCCAGTATTCTCGTCTCAGCACCACCATTTCTTTCATCACTTCCTTTTCGAATCTAAAGTTTGTTCCTCAACGATGGTGTTCTACAGGAGTGTTTCGCTTCTTTCCAAGCTGAGAAATCGTGTTgttcaacagcCTAGCCTGACAAATTCAGTAAGATGGCTGCAAATTCAAACCTCCTCTGACCT...
1557 bp · LXL04_033717|LXL04_033717|OH1004|CDS
ATGTTTTTCGTTTTATTTGTTTTTGTTTACTTATTCAACAACGCACCACCGATCCATTTCTCCCTAAAACCTTTTCCAGTATTCTCGTCTCAGCACCACCATTTCTTTCATCACTTCCTTTTCGAATCTAAAGTTTGTTCCTCAACGATGGTGTTCTACAGGAGTGTTTCGCTTCTTTCCAAGCTGAGAAATCGTGTTGTTCAACAGCCTAGCCTGACAAATTCAGTAAGATGGCTGCAAATTCAAACCTCCTCTGACCT...
Protein
Download Protein FASTA518 aa · LXL04_033717|LXL04_033717|OH1004|PROTEIN
MFFVLFVFVYLFNNAPPIHFSLKPFPVFSSQHHHFFHHFLFESKVCSSTMVFYRSVSLLSKLRNRVVQQPSLTNSVRWLQIQTSSDLDLHSQLKELIPEQQERLKKIKSEYGKVELGKITVDMVLGGMRGMTGLLWETSLLDPDEGIRFRGLSIPECQKVLPAAKPGGEPLPEGLLWLLLTGKVPTKEQVDALSKELRSRATIPDHVYKTIDALPVTAHPMTQFTTGVMALQTQSEFSKAYEKGIHKSKYWEPTFEDSLS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033717 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033717 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:54190981-54195429 (-) | |||||||||
| Description | Similar to CS: Citrate synthase, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006101 citrate metabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0036440 citrate synthase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G44350 ath:AT3G60100 sot:102595372 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00285.27Citrate_synt127-505 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033717 | PF00285.27 | Citrate_synt | 127 | 505 | 7.9e-97 | 325.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.