Gene Card
Gene overview
cDNA / CDS / Protein Sequences
897 bp · LXL04_033669|LXL04_033669|OH1004|cDNA
ATGGATACAGAAATAGCCATATCTTTGATTGTTTCTTGTTTCTTCCTCTTCCTTTACTTTATTCTTAAACCCTCAAAACCATTAAACTTGCCACCAAGGCCCCGAAAGCTACCTTTGATCGGAAACGTACACCAGTTAGCAGGAAAACTCCCTCACCGTGCTTTTCGAGACTTAGCACGAAAACATGGCCCCATCATGCACATCCAACTCGGTCAAATTTCAGCCGTTATTATTTCATCACCTCGATTAGCCGAAGAAGT...
897 bp · LXL04_033669|LXL04_033669|OH1004|CDS
ATGGATACAGAAATAGCCATATCTTTGATTGTTTCTTGTTTCTTCCTCTTCCTTTACTTTATTCTTAAACCCTCAAAACCATTAAACTTGCCACCAAGGCCCCGAAAGCTACCTTTGATCGGAAACGTACACCAGTTAGCAGGAAAACTCCCTCACCGTGCTTTTCGAGACTTAGCACGAAAACATGGCCCCATCATGCACATCCAACTCGGTCAAATTTCAGCCGTTATTATTTCATCACCTCGATTAGCCGAAGAAGT...
Protein
Download Protein FASTA298 aa · LXL04_033669|LXL04_033669|OH1004|PROTEIN
MDTEIAISLIVSCFFLFLYFILKPSKPLNLPPRPRKLPLIGNVHQLAGKLPHRAFRDLARKHGPIMHIQLGQISAVIISSPRLAEEVLKPNDIALADRPTTFGSELVLYGNTDIALALYEQELNGFMELLRLSSGKPIDIQKTVTEVINNVVCIASFGKNCKQQHALLDFLDEFARVNTGFYVADLFPDFKFLYVVSGHRSRLMKLYKTLDKIFDDIWEEHEGGIKDHGGDQEEDLLEVLLRIKEEGGLGIEDILRYKKK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033669 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033669 |
|---|---|
| Location | Chr07:52536197-52538129 (+) |
| Description | Similar to Cytochrome P450 Tp9025 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009753 response to jasmonic acid Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0020037 heme binding Molecular Function GO:0102614 germacrene A acid 8beta-hydroxylase activity Molecular Function GO:0102934 costunolide synthase activity Molecular Function |
| KEGG gene cross-reference | ag:AEG79727 ag:AEI59780 ag:AML23863 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067.28p45031-117 aaPF00067.28p450118-254 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033669 | PF00067.28 | p450 | 31 | 117 | 8.3e-21 | 75.0 |
| LXL04_033669 | PF00067.28 | p450 | 118 | 254 | 8.3e-21 | 75.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.