LXL04_033638 | RubberDandelionOmics

Gene overview

LXL04_033638

Reference: OH-1004 Chr: Chr07 Coordinates: 51044432-51045772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · LXL04_033638|LXL04_033638|OH1004|cDNA

ATGGATTCTCGAAACTCCTCGTTTAGACAATCCAGTGCTTCGAAGATAGATCAGTTATATGAAATAGCTTATCTTTCCGACGAATCAAAAATTCCCATATCCCAATTACCCATAGTAAATCCTTATAATGTTTTTAATAAACCCGTTACTCGTTTCTccagaaaaattaaaaaactaaTCGGATCTACCTCAAACCAACAAGCCAAAGAATATGTTCAAACCTCAAAATTTGATTTTTTCCAGCTTCCAGCCACATCCTC...

CDS

Download CDS FASTA

1185 bp · LXL04_033638|LXL04_033638|OH1004|CDS

ATGGATTCTCGAAACTCCTCGTTTAGACAATCCAGTGCTTCGAAGATAGATCAGTTATATGAAATAGCTTATCTTTCCGACGAATCAAAAATTCCCATATCCCAATTACCCATAGTAAATCCTTATAATGTTTTTAATAAACCCGTTACTCGTTTCTCCAGAAAAATTAAAAAACTAATCGGATCTACCTCAAACCAACAAGCCAAAGAATATGTTCAAACCTCAAAATTTGATTTTTTCCAGCTTCCAGCCACATCCTC...

Protein

Download Protein FASTA

394 aa · LXL04_033638|LXL04_033638|OH1004|PROTEIN

MDSRNSSFRQSSASKIDQLYEIAYLSDESKIPISQLPIVNPYNVFNKPVTRFSRKIKKLIGSTSNQQAKEYVQTSKFDFFQLPATSSEHLVTLSIPPDLPRSCLHQGYTHIHFGAIRLALTFHGRKGLPAFSRIALVDTRFVEYQHACIGTIQTTLNAGTIFVTFYPNFDMPLNDPSLFTALKAQIQIGGTPQVNTFQATFHYQMAYRVQNHSLDIMVLGQANSGDALFLDVDSNATPTCTYVPRQLSRDEILKLLLDKW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033638`
TK1151 ID	TkA08G289860
OH-1004 ID	LXL04_033638
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.100
Protein coverage (%)	TK1151 89.003 / OH-1004 74.873 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033638`
Location	Chr07:51044432-51045772 (+)
Description	Similar to Genome polyprotein (Petunia vein clearing virus (isolate Shepherd)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033638` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0046740 transport of virus in host, cell to cell Biological Process GO:0003677 DNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	vg:921337 vg:940156 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.375

Rank 1 · LXL04_033638 · OH-1004

Nucleus0.230

Rank 2 · LXL04_033638 · OH-1004

Endoplasmic reticulum0.156

Rank 3 · LXL04_033638 · OH-1004

Mitochondrion0.149

Rank 4 · LXL04_033638 · OH-1004

Peroxisome0.087

Rank 5 · LXL04_033638 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01107.24MP40-211 aa

PF17919.8RT_RNaseH_2289-366 aa

PF17917.8RT_RNaseH300-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033638	`PF01107.24`	MP	40	211	1.3e-08	35.4
LXL04_033638	`PF17919.8`	RT_RNaseH_2	289	366	1.8e-14	54.3
LXL04_033638	`PF17917.8`	RT_RNaseH	300	367	3.8e-13	50.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card