LXL04_033611 | RubberDandelionOmics

Gene overview

LXL04_033611

Reference: OH-1004 Chr: Chr07 Coordinates: 49839110-49839904 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

795 bp · LXL04_033611|LXL04_033611|OH1004|cDNA

ATGTCAAACAATTTAGACTTGAGTTCCACTTCCCCTTTCTCCCTCCAAAACCTGCAAAATCGCCCCGACCTCCACCTCCAAATCCCCCCTGATTCCGAAGATGACAACAACCAACACACTCCTGGCTCCGGCAGCGGAAGTGGCGATATTGTTGGCCGGCGACCACGCGGCCGCCCTCCTGGTTCCAAAAACAAGCCAAAACCACCGGTCATCATTACCAGGGAGAGCGCAAATACCCTTCGCGCACACATCCTCGAGAT...

CDS

Download CDS FASTA

795 bp · LXL04_033611|LXL04_033611|OH1004|CDS

ATGTCAAACAATTTAGACTTGAGTTCCACTTCCCCTTTCTCCCTCCAAAACCTGCAAAATCGCCCCGACCTCCACCTCCAAATCCCCCCTGATTCCGAAGATGACAACAACCAACACACTCCTGGCTCCGGCAGCGGAAGTGGCGATATTGTTGGCCGGCGACCACGCGGCCGCCCTCCTGGTTCCAAAAACAAGCCAAAACCACCGGTCATCATTACCAGGGAGAGCGCAAATACCCTTCGCGCACACATCCTCGAGAT...

Protein

Download Protein FASTA

264 aa · LXL04_033611|LXL04_033611|OH1004|PROTEIN

MSNNLDLSSTSPFSLQNLQNRPDLHLQIPPDSEDDNNQHTPGSGSGSGDIVGRRPRGRPPGSKNKPKPPVIITRESANTLRAHILEINSGCDVFESIANYARKRQRGICIVSGSGTVNNVSLRQPAAAGSVLTLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIAASFTNVAYERLPLDEEEAAASSGGGGDGNGGVNHPFHDPSSMGLPFFNLPLNMPNVGLPVDGGGWSGNMAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033611`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033611

Location Chr07:49839110-49839904 (-)

Description Similar to AHL21: AT-hook motif nuclear-localized protein 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35270`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g17800`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g14465`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Overexpression of AHL20 negatively regulates defenses in Arabidopsis.2010 · DOI: 10.1111/j.1744-7909.2010.00969.x
`At2g42940`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At1g76500`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	The AT-hook-containing proteins SOB3/AHL29 and ESC/AHL27 are negative modulators of hypocotyl growth in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2007.03393.x Over-expression of an AT-hook gene, AHL22, delays flowering and inhibits the elongation of the hypocotyl in Arabidopsis thaliana.2009 · DOI: 10.1007/s11103-009-9507-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033611 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048440 carpel development Biological Process

GO:0048653 anther development Biological Process

KEGG gene cross-reference

ath:AT1G76500

ath:AT2G35270

ath:AT2G42940

ath:AT4G14465

ath:AT4G17800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_033611 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_033611 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_033611 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_033611 · OH-1004

Plastid0.011

Rank 5 · LXL04_033611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479.22PCC75-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033611	`PF03479.22`	PCC	75	193	6.5e-33	114.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82166`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 21	65.217%	Swiss-Prot	strong database homology
`O23620`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 23	57.792%	Swiss-Prot	strong database homology
`Q8GWQ2`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 20	54.386%	Swiss-Prot	strong database homology
`Q9SJG4`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 16	64.780%	Swiss-Prot	moderate database homology
`Q9C9K7`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 29	60.656%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card