LXL04_033603 | RubberDandelionOmics

Gene overview

LXL04_033603

Reference: OH-1004 Chr: Chr07 Coordinates: 49160004-49163236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

891 bp · LXL04_033603|LXL04_033603|OH1004|cDNA

ATGCTGACCCTGTTGACTCGGAGGAACCTGCAGCATCTCTTGAACACAGCCCCAAACAACGACACTATTCCGAAAATGCCCTCGGAGGCTGTTATTTCTACCATTCCTGATCCAATTGCTACTTTCCCAGAATTGCTGCAACTGACAGAGCCCTTTCCCATGAAAGCAATACCTCCTTTTGTAAAGAAGTTTAAAACCATAATTCATCCTGGAGAGGTCAATCGCATCAGGGAGCTTCCTCCAAACAGCAAAATTATAGC...

CDS

Download CDS FASTA

891 bp · LXL04_033603|LXL04_033603|OH1004|CDS

ATGCTGACCCTGTTGACTCGGAGGAACCTGCAGCATCTCTTGAACACAGCCCCAAACAACGACACTATTCCGAAAATGCCCTCGGAGGCTGTTATTTCTACCATTCCTGATCCAATTGCTACTTTCCCAGAATTGCTGCAACTGACAGAGCCCTTTCCCATGAAAGCAATACCTCCTTTTGTAAAGAAGTTTAAAACCATAATTCATCCTGGAGAGGTCAATCGCATCAGGGAGCTTCCTCCAAACAGCAAAATTATAGC...

Protein

Download Protein FASTA

296 aa · LXL04_033603|LXL04_033603|OH1004|PROTEIN

MLTLLTRRNLQHLLNTAPNNDTIPKMPSEAVISTIPDPIATFPELLQLTEPFPMKAIPPFVKKFKTIIHPGEVNRIRELPPNSKIIATHTDSGPLKGLWKEAVALNELRQSDTCKILVHIFFAQNNTSKEDDEKSLVAAVAQIKGKLNPFSLSLLLFGVILPSFSANLEMAKENHEKAVSLLKGVLDYDSFKDVDSVVEICQLLDLMFKWLHMEESLTEIVWFPYKFLCRFGHILDFIKRNNSKRFFKDDMEKVIKYQWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033603`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033603

Location Chr07:49160004-49163236 (-)

Description Similar to Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19520`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.	Regulation of flowering time by FVE, a retinoblastoma-associated protein.2004 · DOI: 10.1038/ng1295 A genetic link between cold responses and flowering time through FVE in Arabidopsis thaliana.2004 · DOI: 10.1038/ng1298
`At4g29730`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (By similarity).	Arabidopsis PWWP domain proteins mediate H3K27 trimethylation on FLC and regulate flowering time.2018 · DOI: 10.1111/jipb.12630
`At3g06860`	Involved in peroxisomal fatty acid beta-oxidation during seed germination.	The Arabidopsis thaliana multifunctional protein gene (MFP2) of peroxisomal beta-oxidation is essential for seedling establishment.2006 · DOI: 10.1111/j.1365-313x.2005.02650.x The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005 Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis .2019 · DOI: 10.1073/pnas.1904143116

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033603 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009908 flower development Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

KEGG gene cross-reference

ath:AT2G19520

ath:AT3G06860

ath:AT4G29730

bna:106389027

csv:101210295

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.517

Rank 1 · LXL04_033603 · OH-1004

Cytoplasm0.199

Rank 2 · LXL04_033603 · OH-1004

Nucleus0.180

Rank 3 · LXL04_033603 · OH-1004

Plastid0.086

Rank 4 · LXL04_033603 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_033603 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22607`	Arabidopsis thaliana	WD-40 repeat-containing protein MSI4	45.652%	Swiss-Prot	weak database homology
`Q9SU78`	Arabidopsis thaliana	WD-40 repeat-containing protein MSI5	86.842%	Swiss-Prot	weak database homology
`Q9ZPI5`	Arabidopsis thaliana	Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2	37.956%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card