LXL04_033561 | RubberDandelionOmics

Gene overview

LXL04_033561

Reference: OH-1004 Chr: Chr07 Coordinates: 47626643-47638145 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5400 bp · LXL04_033561|LXL04_033561|OH1004|cDNA

ATGGCTGGAGGTGCTGCGGGAGGTTTTCTTACTCGGGCATTTGAATCAATGCTTAAAGAATGTTCCGGAAAAAAGTATACTTCTGTCCAGACTGCGATTCGTTCTTATCTAGATACTTCAAAAGCGACCAATCAAGAGACGGGATCAAGTAATAACAACAAAACGCCTTTAATTAACGATAAGAGTGATGATGGGACTGAAAGAGCTGAACTGGAGTCTGAAACAAATGCTTCAATTGGAAATATCTCAAAGACTTTGGC...

CDS

Download CDS FASTA

5400 bp · LXL04_033561|LXL04_033561|OH1004|CDS

ATGGCTGGAGGTGCTGCGGGAGGTTTTCTTACTCGGGCATTTGAATCAATGCTTAAAGAATGTTCCGGAAAAAAGTATACTTCTGTCCAGACTGCGATTCGTTCTTATCTAGATACTTCAAAAGCGACCAATCAAGAGACGGGATCAAGTAATAACAACAAAACGCCTTTAATTAACGATAAGAGTGATGATGGGACTGAAAGAGCTGAACTGGAGTCTGAAACAAATGCTTCAATTGGAAATATCTCAAAGACTTTGGC...

Protein

Download Protein FASTA

1799 aa · LXL04_033561|LXL04_033561|OH1004|PROTEIN

MAGGAAGGFLTRAFESMLKECSGKKYTSVQTAIRSYLDTSKATNQETGSSNNNKTPLINDKSDDGTERAELESETNASIGNISKTLANAGQLLEGAQLELVLNPLRLAFETKNPKVIELALDCIHKLIAYDHLEGDPGLEDGKNVPLFTDILNMVCSCVDNNSPDSTILQVLKVLLTAVSSTKFRVHGEPLMGVIRVCYNIALNSKSAVNQATSKAMLTQMINIVFRRMDNDSVSSDYPPIHKRSDSFMKAQETSPLDDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033561`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033561

Location Chr07:47626643-47638145 (+)

Description Similar to BIG5: Brefeldin A-inhibited guanine nucleotide-exchange protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43300`	Activates the ARF proteins by exchanging bound GDP for free GTP.	Effector-triggered immunity blocks pathogen degradation of an immunity-associated vesicle traffic regulator in Arabidopsis.2011 · DOI: 10.1073/pnas.1103338108
`At1g01960`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At4g38200`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At3g60860`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release
`At4g35380`	Activates the ARF proteins by exchanging bound GDP for free GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033561 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006955 immune response Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031338 regulation of vesicle fusion Biological Process

GO:0032012 regulation of ARF protein signal transduction Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043001 Golgi to plasma membrane protein transport Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G01960

ath:AT3G43300

ath:AT3G60860

ath:AT4G38200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.463

Rank 1 · LXL04_033561 · OH-1004

Golgi apparatus0.424

Rank 2 · LXL04_033561 · OH-1004

Cell membrane0.178

Rank 3 · LXL04_033561 · OH-1004

Endoplasmic reticulum0.139

Rank 4 · LXL04_033561 · OH-1004

Lysosome / Vacuole0.137

Rank 5 · LXL04_033561 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16213.12DCB90-232 aa

PF12783.14Sec7-like_HUS320-470 aa

PF01369.26Sec7565-747 aa

PF09324.16Sec7-like_HDS1063-1145 aa

PF16206.10Mon2_C1219-1283 aa

PF23325.2TPR_281222-1314 aa

PF20252.4BIG2_C1526-1710 aa

PF06747.19CHCH1749-1783 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033561	`PF16213.12`	DCB	90	232	7.3e-31	108.0
LXL04_033561	`PF12783.14`	Sec7-like_HUS	320	470	6.6e-40	137.3
LXL04_033561	`PF01369.26`	Sec7	565	747	8.1e-69	231.6
LXL04_033561	`PF09324.16`	Sec7-like_HDS	1063	1145	5.5e-32	110.2
LXL04_033561	`PF16206.10`	Mon2_C	1219	1283	1.8e-06	27.2
LXL04_033561	`PF23325.2`	TPR_28	1222	1314	3.1e-09	37.7
LXL04_033561	`PF20252.4`	BIG2_C	1526	1710	1e-22	81.8
LXL04_033561	`PF06747.19`	CHCH	1749	1783	3.7e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IXW2`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 5	67.046%	Swiss-Prot	strong database homology
`Q9LPC5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 3	37.448%	Swiss-Prot	moderate database homology
`F4JSZ5`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 1	34.940%	Swiss-Prot	moderate database homology
`Q9LZX8`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 2	35.045%	Swiss-Prot	moderate database homology
`F4JN05`	Arabidopsis thaliana	Brefeldin A-inhibited guanine nucleotide-exchange protein 4	34.866%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card