LXL04_033536 | RubberDandelionOmics

Gene overview

LXL04_033536

Reference: OH-1004 Chr: Chr07 Coordinates: 47025761-47029354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1785 bp · LXL04_033536|LXL04_033536|OH1004|cDNA

ATGGGTAGTAGTAGTAAGGAAGTGGCGTTACGGCTGAAGACAGCGGCGGAGACGGCGATCGGATCAATCGGATTAGGGTATGACCTCACTGAGGATTTGAGGTTGAAATACTGTAAAGGGAAGTCACCGGAATCGAGATTGATCGGTATAGATGATGAACAAGTTAGGGATATACTGATTCCAGGTGGGATTTTGATACAAAATGTATCAAAATCGATTAATTGCGATAAAGGTGAAAGGATGCGATTCAGCTCAGATAC...

CDS

Download CDS FASTA

1785 bp · LXL04_033536|LXL04_033536|OH1004|CDS

ATGGGTAGTAGTAGTAAGGAAGTGGCGTTACGGCTGAAGACAGCGGCGGAGACGGCGATCGGATCAATCGGATTAGGGTATGACCTCACTGAGGATTTGAGGTTGAAATACTGTAAAGGGAAGTCACCGGAATCGAGATTGATCGGTATAGATGATGAACAAGTTAGGGATATACTGATTCCAGGTGGGATTTTGATACAAAATGTATCAAAATCGATTAATTGCGATAAAGGTGAAAGGATGCGATTCAGCTCAGATAC...

Protein

Download Protein FASTA

594 aa · LXL04_033536|LXL04_033536|OH1004|PROTEIN

MGSSSKEVALRLKTAAETAIGSIGLGYDLTEDLRLKYCKGKSPESRLIGIDDEQVRDILIPGGILIQNVSKSINCDKGERMRFSSDTLTFQQMSEQFNQDVSLSGRIPTGQLNAAFEFTGSWQKDAANTKSLALDGVFITLYNITLEKSQISLRDHVKNAVPSSWEPAALAKFIERFGTHVISAVKMGGKDVVYMKQQYSSSISLDEVRKKLKDVAEKRFSGQQNDTPRKIHDPELLERNDYGLINLNPPIEDITLFWRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033536`
TK1151 ID	TkA08G271570
OH-1004 ID	LXL04_033536
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033536

Location Chr07:47025761-47029354 (-)

Description Similar to At4g24290: MACPF domain-containing protein At4g24290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24290`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release
`At1g28380`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	Loss of Necrotic Spotted Lesions 1 associates with cell death and defense responses in Arabidopsis thaliana.2006 · DOI: 10.1007/s11103-006-9001-6
`At1g14780`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release
`At1g29690`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033536 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:0012501 programmed cell death Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0072708 response to sorbitol Biological Process

GO:2000031 regulation of salicylic acid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G14780

ath:AT1G28380

ath:AT1G29690

ath:AT4G24290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.299

Rank 1 · LXL04_033536 · OH-1004

Nucleus0.219

Rank 2 · LXL04_033536 · OH-1004

Cell membrane0.206

Rank 3 · LXL04_033536 · OH-1004

Plastid0.140

Rank 4 · LXL04_033536 · OH-1004

Extracellular0.107

Rank 5 · LXL04_033536 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01823.26MACPF23-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033536	`PF01823.26`	MACPF	23	318	5.7e-31	108.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STW5`	Arabidopsis thaliana	MACPF domain-containing protein At4g24290	59.866%	Swiss-Prot	strong database homology
`Q9SGN6`	Arabidopsis thaliana	MACPF domain-containing protein NSL1	48.270%	Swiss-Prot	moderate database homology
`Q8L612`	Arabidopsis thaliana	MACPF domain-containing protein At1g14780	42.370%	Swiss-Prot	moderate database homology
`Q9C7N2`	Arabidopsis thaliana	MACPF domain-containing protein CAD1	41.554%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card