LXL04_033501 | RubberDandelionOmics

Gene overview

LXL04_033501

Reference: OH-1004 Chr: Chr07 Coordinates: 45801451-45802892 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_033501|LXL04_033501|OH1004|cDNA

ATGACAGAGAGTAAAAGGAGGAGGGTTTTCAGCTGTGCTGAGGAAGATAGAATCAGTAACTTGCAAGAACACTTGTTGGACTCGATCTTGGAGCGGGTCCCGATTGAAGATGCAGCAAGGACAAGCATTCTATCAAGAAAGTGGAGGCACACATGGAGGAACATGAGGGCGCTGGTTTTTGATAAACATTTCTCCAATAAATTTGCAAAAAATGGAGCTTTTAGACGCAACATTCCTCCTGATAGCTTCCAAGAAGTTGA...

CDS

Download CDS FASTA

1110 bp · LXL04_033501|LXL04_033501|OH1004|CDS

ATGACAGAGAGTAAAAGGAGGAGGGTTTTCAGCTGTGCTGAGGAAGATAGAATCAGTAACTTGCAAGAACACTTGTTGGACTCGATCTTGGAGCGGGTCCCGATTGAAGATGCAGCAAGGACAAGCATTCTATCAAGAAAGTGGAGGCACACATGGAGGAACATGAGGGCGCTGGTTTTTGATAAACATTTCTCCAATAAATTTGCAAAAAATGGAGCTTTTAGACGCAACATTCCTCCTGATAGCTTCCAAGAAGTTGA...

Protein

Download Protein FASTA

369 aa · LXL04_033501|LXL04_033501|OH1004|PROTEIN

MTESKRRRVFSCAEEDRISNLQEHLLDSILERVPIEDAARTSILSRKWRHTWRNMRALVFDKHFSNKFAKNGAFRRNIPPDSFQEVDQWMYFLSRNGVTEIILTNSNQLYKLPCYMFCCRELRKLKLKHCLFKPPLEFKAFLNLEDLELTNIDFGDNLCGSQISLPQLKTLSLSSVRKLRGSYITIFGIHDFVGGDRKDLSKELSHLPEIKDVHIDSIFRKCLFAENIPKWLPHPVISLKRLRLQFFQVGDLDQLHGALC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033501`
TK1151 ID	TkA08G269440
OH-1004 ID	LXL04_033501
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033501

Location Chr07:45801451-45802892 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At3g59250`	F-box/LRR-repeat protein At3g59250.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At5g53840`	F-box/FBD/LRR-repeat protein At5g53840.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033501 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G04230

ath:AT3G59250

ath:AT4G10400

ath:AT5G53840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.742

Rank 1 · LXL04_033501 · OH-1004

Cytoplasm0.318

Rank 2 · LXL04_033501 · OH-1004

Endoplasmic reticulum0.049

Rank 3 · LXL04_033501 · OH-1004

Cell membrane0.041

Rank 4 · LXL04_033501 · OH-1004

Plastid0.023

Rank 5 · LXL04_033501 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box18-56 aa

PF23622.2LRR_At1g61320_AtMIF182-174 aa

PF24758.2LRR_At5g5637086-157 aa

PF08387.16FBD292-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033501	`PF00646.39`	F-box	18	56	1.1e-06	29.0
LXL04_033501	`PF23622.2`	LRR_At1g61320_AtMIF1	82	174	2.9e-07	30.9
LXL04_033501	`PF24758.2`	LRR_At5g56370	86	157	6.1e-08	33.3
LXL04_033501	`PF08387.16`	FBD	292	334	1.6e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g13570	30.583%	Swiss-Prot	moderate database homology
`Q9LX46`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g59250	27.811%	Swiss-Prot	weak database homology
`Q9SV82`	Arabidopsis thaliana	FBD-associated F-box protein At4g10400	24.760%	Swiss-Prot	weak database homology
`Q9FGQ3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g53840	29.070%	Swiss-Prot	weak database homology
`Q6NKX3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At2g04230	42.254%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card