LXL04_033378 | RubberDandelionOmics

Gene overview

LXL04_033378

Reference: OH-1004 Chr: Chr07 Coordinates: 42121955-42125541 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1782 bp · LXL04_033378|LXL04_033378|OH1004|cDNA

ATGAATGCGGAAACGGCTGTAGAGTTTTTGCTGCCTTCATGGTGGGAGGTCCAAGTAACCGTCGCCGCCGCGTTCTTTGTAATTGCGGCATACTGGTTCTTCACCGACGGCGGTAACATCGGTGCAGGTGATCGATCTCAGTGTGATAACTCCGCTCTTGTTTCCGGTGATGCCGTAGATGACAAAGAAAAGATAGATCAACAGAAGGGCGACTCTCATGGCACCTCCGCTTACATCATAAAGGTGGAACTGTTAGCAGC...

CDS

Download CDS FASTA

1782 bp · LXL04_033378|LXL04_033378|OH1004|CDS

ATGAATGCGGAAACGGCTGTAGAGTTTTTGCTGCCTTCATGGTGGGAGGTCCAAGTAACCGTCGCCGCCGCGTTCTTTGTAATTGCGGCATACTGGTTCTTCACCGACGGCGGTAACATCGGTGCAGGTGATCGATCTCAGTGTGATAACTCCGCTCTTGTTTCCGGTGATGCCGTAGATGACAAAGAAAAGATAGATCAACAGAAGGGCGACTCTCATGGCACCTCCGCTTACATCATAAAGGTGGAACTGTTAGCAGC...

Protein

Download Protein FASTA

593 aa · LXL04_033378|LXL04_033378|OH1004|PROTEIN

MNAETAVEFLLPSWWEVQVTVAAAFFVIAAYWFFTDGGNIGAGDRSQCDNSALVSGDAVDDKEKIDQQKGDSHGTSAYIIKVELLAAKNLIGANLNGMSDPYAIITCGTEKRFSSMVPGSRNPMWGEEFDFSVEELPVKINVSIYDWDIIWKSAVLGSVTIPVENEGHTGAIWHPFNNSPGQVCLNIRTVKHSMNSSRGLKGYVGANPRRRASVYKEGPIVVHQKPGPLQTIFDLLPDEASCSTQLFMCNGKIILVSWSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033378`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033378

Location Chr07:42121955-42125541 (-)

Description Similar to BAGP1: BAG-associated GRAM protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59660`	Involved in proteolytic processing of BAG6.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At1g03370`	C2 and GRAM domain-containing protein At1g03370.	No verified direct reference in this release
`At1g63220`	Binds to both sense and antisense RNA (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G03370

ath:AT1G63220

ath:AT3G59660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.275

Rank 1 · LXL04_033378 · OH-1004

Endoplasmic reticulum0.245

Rank 2 · LXL04_033378 · OH-1004

Cytoplasm0.223

Rank 3 · LXL04_033378 · OH-1004

Cell membrane0.199

Rank 4 · LXL04_033378 · OH-1004

Nucleus0.141

Rank 5 · LXL04_033378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C280-174 aa

PF16016.12VASt412-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033378	`PF00168.37`	C2	80	174	1.6e-16	61.2
LXL04_033378	`PF16016.12`	VASt	412	558	3e-31	109.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4D4`	Arabidopsis thaliana	BAG-associated GRAM protein 1	60.374%	Swiss-Prot	strong database homology
`Q9ZVT9`	Arabidopsis thaliana	C2 and GRAM domain-containing protein At1g03370	21.495%	Swiss-Prot	weak database homology
`Q9C8S6`	Arabidopsis thaliana	16 kDa phloem protein 2	30.137%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card