LXL04_033298 | RubberDandelionOmics

Gene overview

LXL04_033298

Reference: OH-1004 Chr: Chr07 Coordinates: 40431935-40436803 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2930 bp · LXL04_033298|LXL04_033298|OH1004|cDNA

GCGACTTTCTATTTTTCCCTCCAAAGGCCAAAGGGTCATCCCCATCGGCCTCTCTTTGACACACAACACAAACGCAGATTCATCCACGCCGTCACGCCGAGCCCGGATCGGAGATGGAGATGGAGACGGAAATGGACATGCCGATGCCGGACGAACTCGAATGGCTTGAAGCCGATTTGCAACACCACGAAGACTATCTCGATGAAGATATTGAACCACCACTACCCGAAGAAGAAGCATCCTACATCGAAGAAGTATAT...

CDS

Download CDS FASTA

2817 bp · LXL04_033298|LXL04_033298|OH1004|CDS

ATGGAGATGGAGACGGAAATGGACATGCCGATGCCGGACGAACTCGAATGGCTTGAAGCCGATTTGCAACACCACGAAGACTATCTCGATGAAGATATTGAACCACCACTACCCGAAGAAGAAGCATCCTACATCGAAGAAGTATATGAAGTTCTACAACCCGAACCCATCGTTAAACCAAGTTTACCGATCCTGGAAAAAGTACAGCCGAAGAAGCGATTCCGCCCATTAAGCCCTAATTTACTCGACCTTACCAATGC...

Protein

Download Protein FASTA

938 aa · LXL04_033298|LXL04_033298|OH1004|PROTEIN

MEMETEMDMPMPDELEWLEADLQHHEDYLDEDIEPPLPEEEASYIEEVYEVLQPEPIVKPSLPILEKVQPKKRFRPLSPNLLDLTNADNSVEDKRCKVDDSSAIDADDDWLRYSPPPKDESVVIVEEEEKETFISRYLTDIEGDFMPVTAPDGNRVYAKLVKEEKNEKLKKLNVKAPSKGLMLEPISVLMQRAEEDALQKALQASVSSEIDANLVGTPVVSERLWVDKYSPNSFMELLSDEHTNREVLLWLKQWDSSVFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033298`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033298`
Location	Chr07:40431935-40436803 (-)
Description	Similar to chtf18: Chromosome transmission fidelity protein 18 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033298` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0045005 DNA-templated DNA replication maintenance of fidelity Biological Process GO:0048468 cell development Biological Process GO:0051985 negative regulation of chromosome segregation Biological Process GO:1900264 positive regulation of DNA-directed DNA polymerase activity Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005663 DNA replication factor C complex Cellular Component
KEGG gene cross-reference	dme:Dmel_CG33122 hsa:63922 mmu:214901 spo:2541270 xla:414577 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · LXL04_033298 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_033298 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_033298 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_033298 · OH-1004

Golgi apparatus0.008

Rank 5 · LXL04_033298 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA333-442 aa

PF25361.2AAA_lid_RFC1476-525 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033298	`PF00004.36`	AAA	333	442	8.1e-13	49.7
LXL04_033298	`PF25361.2`	AAA_lid_RFC1	476	525	1.6e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card