LXL04_033297 | RubberDandelionOmics

Gene overview

LXL04_033297

Reference: OH-1004 Chr: Chr07 Coordinates: 40428030-40431393 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_033297|LXL04_033297|OH1004|cDNA

ATGACGAACGAAGGAGGAGGCGGTTCAGGGGGAGCAAGTGCGGTGAATCTCACAGATTTCGCGCTTATTTCAGAAGGTCGTGTCTCGCACATTCTATCACACACCTCACCTCGTGATGCGGGTACAGCTTCTTCGATTTCTAGGGGTTTCAAGTTTTTCGCTAATTCTGATGCCGTTTGGGAGCAATTTTTACCGGCCGATTACCAGGAGATCATTTCTCGGTCCGTTTCTCCGGTGGTCTATTCTTCCAAGAAAGAATT...

CDS

Download CDS FASTA

855 bp · LXL04_033297|LXL04_033297|OH1004|CDS

ATGACGAACGAAGGAGGAGGCGGTTCAGGGGGAGCAAGTGCGGTGAATCTCACAGATTTCGCGCTTATTTCAGAAGGTCGTGTCTCGCACATTCTATCACACACCTCACCTCGTGATGCGGGTACAGCTTCTTCGATTTCTAGGGGTTTCAAGTTTTTCGCTAATTCTGATGCCGTTTGGGAGCAATTTTTACCGGCCGATTACCAGGAGATCATTTCTCGGTCCGTTTCTCCGGTGGTCTATTCTTCCAAGAAAGAATT...

Protein

Download Protein FASTA

284 aa · LXL04_033297|LXL04_033297|OH1004|PROTEIN

MTNEGGGGSGGASAVNLTDFALISEGRVSHILSHTSPRDAGTASSISRGFKFFANSDAVWEQFLPADYQEIISRSVSPVVYSSKKELYFRLCDSPILIDDGNMSFSLNKHNGKKCFMVGAKALSIAWQDTLVFWRWRTLPESRFSKVAELLAVCWLEIKGKIRTSMLSSETSYAAYLVYKIGDISHGLDFPGKTMIRHNGDDVAVTTVHIKPPKDGENLQGSGDADVMGVGPRTRADGFMEIELGRFYNNGETDEEVEMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033297`
TK1151 ID	TkA08G249190
OH-1004 ID	LXL04_033297
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033297

Location Chr07:40428030-40431393 (+)

Description Similar to PP2B2: Putative F-box protein PP2-B2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02250`	Putative F-box protein PP2-B2.	No verified direct reference in this release
`At2g02240`	F-box protein At2g02240.	No verified direct reference in this release
`At2g02360`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g02230`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g24560`	Putative F-box protein PP2-B12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033297 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G02230

ath:AT2G02240

ath:AT2G02250

ath:AT2G02360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.548

Rank 1 · LXL04_033297 · OH-1004

Cytoplasm0.526

Rank 2 · LXL04_033297 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_033297 · OH-1004

Endoplasmic reticulum0.069

Rank 4 · LXL04_033297 · OH-1004

Lysosome / Vacuole0.032

Rank 5 · LXL04_033297 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14299.14PP2113-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033297	`PF14299.14`	PP2	113	282	3.3e-49	167.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVR5`	Arabidopsis thaliana	Putative F-box protein PP2-B2	41.667%	Swiss-Prot	moderate database homology
`Q3E6P4`	Arabidopsis thaliana	F-box protein At2g02240	42.481%	Swiss-Prot	moderate database homology
`Q9ZVQ6`	Arabidopsis thaliana	F-box protein PP2-B10	43.173%	Swiss-Prot	moderate database homology
`Q6NPT8`	Arabidopsis thaliana	F-box protein PP2-B1	36.977%	Swiss-Prot	moderate database homology
`Q9FLU7`	Arabidopsis thaliana	Putative F-box protein PP2-B12	42.105%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card