Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · LXL04_033296|LXL04_033296|OH1004|cDNA
ATGTTTTCATTGTTTTATGGACTTTGGAAATATCTTGTTAGTAAGACAGAGTTTCATGTACTGATTCTTGGAATCGACAAGGCTGGAAAAACAACCTTACTTGAGAAACTGAAGACACAATATTCAAGTTTAGAAGGCCTGCCCCCTGACCGAATAGTTCCTACAGTTGGACTCAATATTGGTCGAATAGAAACTTCAAATTCAAAACTTGTGTTTTGGGACCTTGGAGGTCAGTCTGGTCTTCGGTCAATTTGGGAGAA...
618 bp · LXL04_033296|LXL04_033296|OH1004|CDS
ATGTTTTCATTGTTTTATGGACTTTGGAAATATCTTGTTAGTAAGACAGAGTTTCATGTACTGATTCTTGGAATCGACAAGGCTGGAAAAACAACCTTACTTGAGAAACTGAAGACACAATATTCAAGTTTAGAAGGCCTGCCCCCTGACCGAATAGTTCCTACAGTTGGACTCAATATTGGTCGAATAGAAACTTCAAATTCAAAACTTGTGTTTTGGGACCTTGGAGGTCAGTCTGGTCTTCGGTCAATTTGGGAGAA...
Protein
Download Protein FASTA205 aa · LXL04_033296|LXL04_033296|OH1004|PROTEIN
MFSLFYGLWKYLVSKTEFHVLILGIDKAGKTTLLEKLKTQYSSLEGLPPDRIVPTVGLNIGRIETSNSKLVFWDLGGQSGLRSIWEKYYEEAHAVIFVVDASCPSRFEESKSALEKVLRHEDLQGAPLLILANKQDLADAVTSEELGQYLDLKKLDERAYAFEAVSGYDGTGIKETVNWLVDVMERSKRTEMLRVRAGVANGSGA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033296 |
|---|---|
| TK1151 ID | TkA08G249140 |
| OH-1004 ID | LXL04_033296 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033296 |
|---|---|
| Location | Chr07:40419049-40420668 (-) |
| Description | Similar to Arfrp1: ADP-ribosylation factor-related protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0007165 signal transduction Biological Process GO:0034067 protein localization to Golgi apparatus Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0032588 trans-Golgi network membrane Cellular Component GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function |
| KEGG gene cross-reference | bta:525394 hsa:10139 mmu:76688 pon:100444340 rno:117051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00025.28Arf12-182 aaPF09439.17SRPRB19-147 aaPF00071.29Ras20-182 aaPF08477.20Roc20-136 aaPF01926.30MMR_HSR120-134 aaPF00503.27G-alpha53-137 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033296 | PF00025.28 | Arf | 12 | 182 | 3.6e-50 | 170.5 |
| LXL04_033296 | PF09439.17 | SRPRB | 19 | 147 | 2.5e-07 | 31.0 |
| LXL04_033296 | PF00071.29 | Ras | 20 | 182 | 2.5e-11 | 44.1 |
| LXL04_033296 | PF08477.20 | Roc | 20 | 136 | 2.6e-11 | 44.5 |
| LXL04_033296 | PF01926.30 | MMR_HSR1 | 20 | 134 | 1.3e-07 | 32.5 |
| LXL04_033296 | PF00503.27 | G-alpha | 53 | 137 | 2.1e-12 | 47.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.