LXL04_033285 | RubberDandelionOmics

Gene overview

LXL04_033285

Reference: OH-1004 Chr: Chr07 Coordinates: 40308817-40314694 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_033285|LXL04_033285|OH1004|cDNA

ATGCTTCATGTCAAAGAAGGCGAAACAGTAGCTGTAAATTGCATCTTACAGCTTCACAAAATGCTGTATGATAACACCGGCGGCGCTCTAAAAGATTTTTTCCGGTTAATTCAAAGCACAAACCCTAGCATTGTTGTGGTGGCGGAGCAGGAATCAGAGCACAACGATGCCATTCTGGAAAAGAGAGTTTCGAATTCATTGATTTTGATCAATGTTAACTGCAATGAATTTAAGGAGTCCATACTCCATATGCTCGAGAA...

CDS

Download CDS FASTA

1020 bp · LXL04_033285|LXL04_033285|OH1004|CDS

ATGCTTCATGTCAAAGAAGGCGAAACAGTAGCTGTAAATTGCATCTTACAGCTTCACAAAATGCTGTATGATAACACCGGCGGCGCTCTAAAAGATTTTTTCCGGTTAATTCAAAGCACAAACCCTAGCATTGTTGTGGTGGCGGAGCAGGAATCAGAGCACAACGATGCCATTCTGGAAAAGAGAGTTTCGAATTCATTGATTTTGATCAATGTTAACTGCAATGAATTTAAGGAGTCCATACTCCATATGCTCGAGAA...

Protein

Download Protein FASTA

339 aa · LXL04_033285|LXL04_033285|OH1004|PROTEIN

MLHVKEGETVAVNCILQLHKMLYDNTGGALKDFFRLIQSTNPSIVVVAEQESEHNDAILEKRVSNSLILINVNCNEFKESILHMLEKLWQNINPFHKPKGSRSESKFRCLREPGFYKYGNWKRHKPSKKGNAIGLKIGRRWSLANIWDSSDAMNEDKEEGERSASCTATFVLKLPSSCPTSQSPPTRRRRRPPPPPTKYLLPQVSIFKLCFIFSFEYTVKNLNDVYDNMSKKKPTVIWKECADKTFLEACIHELTTNGRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033285`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033285

Location Chr07:40308817-40314694 (+)

Description Similar to SCL28: Scarecrow-like protein 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63100`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At5g05800`	Transcriptional repressor that associates with ribosomal protein promoters.	NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0127800`	Probable transcription factor that acts as a positive regulator of brassinosteroid (BR) signaling.	SMALL ORGAN SIZE 1 and SMALL ORGAN SIZE 2/DWARF AND LOW-TILLERING Form a Complex to Integrate Auxin and Brassinosteroid Signaling in Rice.2017 · DOI: 10.1016/j.molp.2016.12.013
`Os05g0574900`	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway.	Overproduction of OsSLRL2 alters the development of transgenic Arabidopsis plants.2007 · DOI: 10.1016/j.bbrc.2007.04.205

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033285 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G63100

ath:AT5G05800

dosa:Os05g0574900

dosa:Os06g0127800

osa:4339687

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.522

Rank 1 · LXL04_033285 · OH-1004

Cytoplasm0.348

Rank 2 · LXL04_033285 · OH-1004

Mitochondrion0.072

Rank 3 · LXL04_033285 · OH-1004

Cell membrane0.069

Rank 4 · LXL04_033285 · OH-1004

Endoplasmic reticulum0.061

Rank 5 · LXL04_033285 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS1-67 aa

PF12776.14Myb_DNA-bind_3238-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033285	`PF03514.21`	GRAS	1	67	7.5e-14	52.1
LXL04_033285	`PF12776.14`	Myb_DNA-bind_3	238	330	2.2e-15	58.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAN3`	Arabidopsis thaliana	Scarecrow-like protein 28	67.164%	Swiss-Prot	weak database homology
`Q9FFJ8`	Arabidopsis thaliana	L10-interacting MYB domain-containing protein	23.958%	Swiss-Prot	weak database homology
`Q9LWU9`	Oryza sativa subsp. japonica	Protein DWARF AND LOW-TILLERING	50.000%	Swiss-Prot	weak database homology
`Q6F368`	Oryza sativa subsp. japonica	Protein SLENDER RICE1-LIKE 2	38.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card