LXL04_033266 | RubberDandelionOmics

Gene overview

LXL04_033266

Reference: OH-1004 Chr: Chr07 Coordinates: 39813825-39816554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_033266|LXL04_033266|OH1004|cDNA

TGATTAATCTCAGCAGAAGACAAATTTCCCCCACCAGCCTAAAGAATTGACAAAAAGACCCCTGCTCCAAACAACCATTGCTAAACAAGTGCCAGATATACCCAGTCCCCAAGTGTTGTTATGAATAGTGCGCAAGAGTTTTATATTGTTGGTGACGACACGTGTCATATTTTATGGGATGCGAGAACCGGATCTTCTCCAGTTGTTAAGGAAAATAAAATAATAGCAATGTCCACCAcaattaaagaagtgcaggctga...

CDS

Download CDS FASTA

528 bp · LXL04_033266|LXL04_033266|OH1004|CDS

ATGAATAGTGCGCAAGAGTTTTATATTGTTGGTGACGACACGTGTCATATTTTATGGGATGCGAGAACCGGATCTTCTCCAGTTGTTAAGGAAAATAAAATAATAGCAATGTCCACCACAATTAAAGAAGTGCAGGCTGAATTAGAAGCATCTCCAACCATGAGGGAAATTCAAAGAGATGTGACTGAAGCATCTACACAGTCAGAGATATCAGAAGTCGAAGACCAGTTAATCAATAAACAAGAATCCGTTCAAGATAA...

Protein

Download Protein FASTA

175 aa · LXL04_033266|LXL04_033266|OH1004|PROTEIN

MNSAQEFYIVGDDTCHILWDARTGSSPVVKENKIIAMSTTIKEVQAELEASPTMREIQRDVTEASTQSEISEVEDQLINKQESVQDKGHVFKSLHTSGLVPPQGNVIAHRLDGIWLVNVLVRPRNLHPVYCFVTLDTGKRHDLHTQQESHNKNLERNISLIRCGDYMISLCSQFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033266`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033266

Location Chr07:39813825-39816554 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24460`	Tethering factor involved in vesicle fusion at the trans- Golgi network (TGN) thus being required for efficient protein trafficking to the vacuole.	TNO1 is involved in salt tolerance and vacuolar trafficking in Arabidopsis.2011 · DOI: 10.1104/pp.110.168963 TNO1, a TGN-localized SNARE-interacting protein, modulates root skewing in Arabidopsis thaliana.2017 · DOI: 10.1186/s12870-017-1024-4
`At2g19520`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.	Regulation of flowering time by FVE, a retinoblastoma-associated protein.2004 · DOI: 10.1038/ng1295 A genetic link between cold responses and flowering time through FVE in Arabidopsis thaliana.2004 · DOI: 10.1038/ng1298
`At4g29730`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (By similarity).	Arabidopsis PWWP domain proteins mediate H3K27 trimethylation on FLC and regulate flowering time.2018 · DOI: 10.1111/jipb.12630

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033266 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006623 protein targeting to vacuole Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009908 flower development Biological Process

GO:0010015 root morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G24460

ath:AT2G19520

ath:AT4G29730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.459

Rank 1 · LXL04_033266 · OH-1004

Cytoplasm0.417

Rank 2 · LXL04_033266 · OH-1004

Mitochondrion0.130

Rank 3 · LXL04_033266 · OH-1004

Cell membrane0.068

Rank 4 · LXL04_033266 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_033266 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I9A2`	Arabidopsis thaliana	Trans-Golgi network-localized SYP41-interacting protein 1	47.458%	Swiss-Prot	weak database homology
`O22607`	Arabidopsis thaliana	WD-40 repeat-containing protein MSI4	70.968%	Swiss-Prot	weak database homology
`Q9SU78`	Arabidopsis thaliana	WD-40 repeat-containing protein MSI5	65.625%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card