Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1296 bp · LXL04_033239|LXL04_033239|OH1004|cDNA
ATGACCATGAACCACCGCCATTTCCTTCTCGTATCTTTACCATTCCAAAGCCACATCAACCCCGCTTTCCGACTAGCCACCAAACTCATACGCGCCGGTGCTCAAGTCACCTTGGCCACCACCGTCGACGGCCTCAAAACCCGCCCTGCAGTCCCCGGTTTATCTTACCATTTCTTCTTCGACGACGGTGCTGCCGGAAAACCAGGCTACATTCAAAAAATCAAGCTCGTTGGGCCCACGAACCTCAAAAAGCTCTTGGT...
1296 bp · LXL04_033239|LXL04_033239|OH1004|CDS
ATGACCATGAACCACCGCCATTTCCTTCTCGTATCTTTACCATTCCAAAGCCACATCAACCCCGCTTTCCGACTAGCCACCAAACTCATACGCGCCGGTGCTCAAGTCACCTTGGCCACCACCGTCGACGGCCTCAAAACCCGCCCTGCAGTCCCCGGTTTATCTTACCATTTCTTCTTCGACGACGGTGCTGCCGGAAAACCAGGCTACATTCAAAAAATCAAGCTCGTTGGGCCCACGAACCTCAAAAAGCTCTTGGT...
Protein
Download Protein FASTA431 aa · LXL04_033239|LXL04_033239|OH1004|PROTEIN
MTMNHRHFLLVSLPFQSHINPAFRLATKLIRAGAQVTLATTVDGLKTRPAVPGLSYHFFFDDGAAGKPGYIQKIKLVGPTNLKKLLVTVANEGHKVDFLIYGICLPWVAEVAREHHVPSALFYIQSAASFSVAYHLYKTDGGLVNTDIDYTGTLKVPGLPLLKYSEVPPFLLPTDPLALVFQEHIEIVEKDPNSFVLLNSFNYLEEESIEAVSDRINIFSVGPLVSGETEEPYVSDTFQDSDRGTYLRWLDSKPEKSVVY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033239 |
|---|---|
| TK1151 ID | TkA08G243200 |
| OH-1004 ID | LXL04_033239 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 97.950 / OH-1004 99.768Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033239 |
|---|---|
| Location | Chr07:39023447-39024742 (+) |
| Description | Similar to UGT75L6: Crocetin glucosyltransferase, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process GO:0009835 fruit ripening Biological Process GO:0009845 seed germination Biological Process GO:0043473 pigmentation Biological Process GO:0080148 negative regulation of response to water deprivation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0008194 UDP-glycosyltransferase activity Molecular Function |
| KEGG gene cross-reference | ag:BAA36421 ag:BAK55736 mdm:103443397 sly:101250450 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00201.25UDPGT250-412 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033239 | PF00201.25 | UDPGT | 250 | 412 | 4.1e-26 | 92.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.