Gene Card
Gene overview
cDNA / CDS / Protein Sequences
651 bp · LXL04_033138|LXL04_033138|OH1004|cDNA
ATGGACGGCAACAGAAGCAAGATGAGGATGAAGGAACCGATAAAGAGGAGAAATAGCTCCGTAGAGAAGGAGAAAATGGCGTTTAACCTTTCTTCTCCTTCACCTTCCGCAATTACACTTCTGCCTTCTCAGTCAAACGCTCGACATGCTCTTAAATCCAATTTGAAGTTGATAAGCAATCATCGAGTGAGATGTAGCGCAGAACCCGAAAGCGCCTCAAATGTTCCAGACACCTCAGAGGAACCTATCACGACAAAGCC...
651 bp · LXL04_033138|LXL04_033138|OH1004|CDS
ATGGACGGCAACAGAAGCAAGATGAGGATGAAGGAACCGATAAAGAGGAGAAATAGCTCCGTAGAGAAGGAGAAAATGGCGTTTAACCTTTCTTCTCCTTCACCTTCCGCAATTACACTTCTGCCTTCTCAGTCAAACGCTCGACATGCTCTTAAATCCAATTTGAAGTTGATAAGCAATCATCGAGTGAGATGTAGCGCAGAACCCGAAAGCGCCTCAAATGTTCCAGACACCTCAGAGGAACCTATCACGACAAAGCC...
Protein
Download Protein FASTA216 aa · LXL04_033138|LXL04_033138|OH1004|PROTEIN
MDGNRSKMRMKEPIKRRNSSVEKEKMAFNLSSPSPSAITLLPSQSNARHALKSNLKLISNHRVRCSAEPESASNVPDTSEEPITTKPQNQLTSRRICLACLTSSLPLISNSSSRHNQASAIGSDAKERPAACRNCGGGGAIICEMCGGTGKWKALNRKRAKDTYEFTECPNCYGRGKLVCPVCLGTGLPNNKGLLRRPDAKQLLEKMYNGRLLPNS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033138 |
|---|---|
| TK1151 ID | TkA08G234140 |
| OH-1004 ID | LXL04_033138 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 88.426Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033138 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:36947004-36948495 (-) | ||||||||||||
| Description | Similar to PSA2: Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0009561 megagametogenesis Biological Process GO:0010027 thylakoid membrane organization Biological Process GO:0048564 photosystem I assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009543 chloroplast thylakoid lumen Cellular Component GO:0031977 thylakoid lumen Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0047134 protein-disulfide reductase [NAD(P)H] activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G34860 dosa:Os08g0463900 osa:4345779 zma:100277608 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30758.1Orange_C132-188 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033138 | PF30758.1 | Orange_C | 132 | 188 | 2.4e-07 | 31.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.