LXL04_033130 | RubberDandelionOmics

Gene overview

LXL04_033130

Reference: OH-1004 Chr: Chr07 Coordinates: 36847458-36857097 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5766 bp · LXL04_033130|LXL04_033130|OH1004|cDNA

ATGTCTAATGTTGGGAATCTATGGGAGCGTTTGGTCCGTGCTGCACTTCGAAGGGAGAGGACAGGAATTGATGCTTATGGGCGGCCAGCTGGTGGCATTGCTGGAAATGTCCCATCTTCACTTTCCAACAGTAGGGACATAGACCCTATCTTAAGAGCAGCTGATGAAATTCAAGATGAAGACCCCACCATTTCCAGAATTCTATGTGAGTATGCTTACACACTGGCTCAAAATCTCGACCCTAACAGTGAAGGGAGGGG...

CDS

Download CDS FASTA

5766 bp · LXL04_033130|LXL04_033130|OH1004|CDS

ATGTCTAATGTTGGGAATCTATGGGAGCGTTTGGTCCGTGCTGCACTTCGAAGGGAGAGGACAGGAATTGATGCTTATGGGCGGCCAGCTGGTGGCATTGCTGGAAATGTCCCATCTTCACTTTCCAACAGTAGGGACATAGACCCTATCTTAAGAGCAGCTGATGAAATTCAAGATGAAGACCCCACCATTTCCAGAATTCTATGTGAGTATGCTTACACACTGGCTCAAAATCTCGACCCTAACAGTGAAGGGAGGGG...

Protein

Download Protein FASTA

1921 aa · LXL04_033130|LXL04_033130|OH1004|PROTEIN

MSNVGNLWERLVRAALRRERTGIDAYGRPAGGIAGNVPSSLSNSRDIDPILRAADEIQDEDPTISRILCEYAYTLAQNLDPNSEGRGVLQFKTGLMSIIKQKLANREGGGIDRSRDITRLQEFYRLYREKNNVDKLREEEMELRESGTFSGNFQELERKTVKRKRVFATLKVLGTVLEQLAKEVSPEEAEGLIPQDLKRVIESDAAMTEDLIAYNIIPLDAPAVTNTITSFPEVRAAISSLKYFRGLPKLPANFPIPATR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033130`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033130

Location Chr07:36847458-36857097 (+)

Description Similar to CALS9: Callose synthase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07160`	Involved in sporophytic and gametophytic development.	Dual function of Arabidopsis glucan synthase-like genes GSL8 and GSL10 in male gametophyte development and plant growth.2008 · DOI: 10.1111/j.1365-313x.2008.03462.x
`At2g36850`	Involved in sporophytic and gametophytic development.	Dual function of Arabidopsis glucan synthase-like genes GSL8 and GSL10 in male gametophyte development and plant growth.2008 · DOI: 10.1111/j.1365-313x.2008.03462.x Dysregulation of cell-to-cell connectivity and stomatal patterning by loss-of-function mutation in Arabidopsis chorus (glucan synthase-like 8).2010 · DOI: 10.1242/dev.049197
`At1g05570`	Involved in callose synthesis at the forming cell plate during cytokinesis.	An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097
`At2g13680`	Required for the formation of the callose wall separating the tetraspores (interstitial wall) and surrounding the pollen mother cells (peripheral wall).	Callose synthase (CalS5) is required for exine formation during microgametogenesis and for pollen viability in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02379.x Callose (beta-1,3 glucan) is essential for Arabidopsis pollen wall patterning, but not tube growth.2005 · DOI: 10.1186/1471-2229-5-22
`At2g31960`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033130 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0048589 developmental growth Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0052543 callose deposition in cell wall Biological Process

GO:0055047 generative cell mitosis Biological Process

GO:0071555 cell wall organization Biological Process

KEGG gene cross-reference

ath:AT1G05570

ath:AT2G13680

ath:AT2G31960

ath:AT2G36850

ath:AT3G07160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.585

Rank 1 · LXL04_033130 · OH-1004

Endoplasmic reticulum0.210

Rank 2 · LXL04_033130 · OH-1004

Golgi apparatus0.117

Rank 3 · LXL04_033130 · OH-1004

Cytoplasm0.111

Rank 4 · LXL04_033130 · OH-1004

Lysosome / Vacuole0.096

Rank 5 · LXL04_033130 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14288.12FKS1_dom1346-454 aa

PF25968.1CALS1850-1026 aa

PF02364.22Glucan_synthase1033-1725 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033130	`PF14288.12`	FKS1_dom1	346	454	5.3e-42	143.4
LXL04_033130	`PF25968.1`	CALS1	850	1026	7.8e-43	147.0
LXL04_033130	`PF02364.22`	Glucan_synthase	1033	1725	3.4e-231	770.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFU6`	Arabidopsis thaliana	Callose synthase 9	73.410%	Swiss-Prot	strong database homology
`Q9SJM0`	Arabidopsis thaliana	Callose synthase 10	62.187%	Swiss-Prot	strong database homology
`Q9AUE0`	Arabidopsis thaliana	Callose synthase 1	44.541%	Swiss-Prot	moderate database homology
`Q3B724`	Arabidopsis thaliana	Callose synthase 5	45.587%	Swiss-Prot	moderate database homology
`Q9SL03`	Arabidopsis thaliana	Callose synthase 2	44.813%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card