LXL04_033127 | RubberDandelionOmics

Gene overview

LXL04_033127

Reference: OH-1004 Chr: Chr07 Coordinates: 36804871-36808196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2101 bp · LXL04_033127|LXL04_033127|OH1004|cDNA

ACCAACACTTTGTTTACATCACGCTTTTCCAAATTTTCTAACGTCTGTGATTTATCTCTTGGTTGTTTCTGCACATGTTTTTGAGTTAGTGTTTGTATTAGATTTTTCTATTATTAGAATAGTGAAGGAATGGAATCTTGATAGTCAACCATTGACTCAATTTTTGTAACAGGAATTGCTTGAACTATTTGGAATGCCAGTTTTGAAAGCAAGTGGAGAAGCTGAAGGACTTTGTGCACAATTAAATAGAGAAGGCCGTG...

CDS

Download CDS FASTA

1926 bp · LXL04_033127|LXL04_033127|OH1004|CDS

TTGCTTGAACTATTTGGAATGCCAGTTTTGAAAGCAAGTGGAGAAGCTGAAGGACTTTGTGCACAATTAAATAGAGAAGGCCGTGTTGATGCTTGTATTACTTCTGATAGTGATGCGTTTCTTTTTGGTGCCAAATGTATCATTAAAAACATTAAGCCCAATTCACAGGAACCATTTGAGTGCTATGAAATGTCGGATGTGGAAATTGGATTAGGGTTAAAGAGAAAACATTTAATAGCAATTGGACTTTTGGTTGGAAA...

Protein

Download Protein FASTA

641 aa · LXL04_033127|LXL04_033127|OH1004|PROTEIN

MLELFGMPVLKASGEAEGLCAQLNREGRVDACITSDSDAFLFGAKCIIKNIKPNSQEPFECYEMSDVEIGLGLKRKHLIAIGLLVGNDHDLKGVQGIEIETALSFVKSFNEDEVLDRLCGLGSGNMLPIAYEGDLVNNLDENTTKIKLSHCSLCGHPGKPNFPNKEIIEMYLSNNHSNFTGMFRNPKSRNRIITLCGHPGSKRSHLKDSYEVCISNNHQSCVQKPIGFKCNCMSCDQDKKEKEQKKNEAWKMRVCSKIST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033127`
TK1151 ID	TkA07G429260
OH-1004 ID	LXL04_033127
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 39.314 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033127

Location Chr07:36804871-36808196 (+)

Description Similar to RAD: Flap endonuclease GEN-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01880`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	AtGEN1 and AtSEND1, two paralogs in Arabidopsis, possess holliday junction resolvase activity.2014 · DOI: 10.1104/pp.114.237834

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0521900`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA.	No verified direct reference in this release
`Os08g0101600`	Single-stranded DNA endonuclease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033127 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0009555 pollen development Biological Process

GO:0009650 UV protection Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0031297 replication fork processing Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0071140 resolution of mitotic recombination intermediates Biological Process

GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

GO:0005634 nucleus Cellular Component

GO:0005813 centrosome Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01880

mmu:209334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.854

Rank 1 · LXL04_033127 · OH-1004

Cytoplasm0.239

Rank 2 · LXL04_033127 · OH-1004

Mitochondrion0.054

Rank 3 · LXL04_033127 · OH-1004

Cell membrane0.025

Rank 4 · LXL04_033127 · OH-1004

Golgi apparatus0.013

Rank 5 · LXL04_033127 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00867.24XPG_I6-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033127	`PF00867.24`	XPG_I	6	88	2.1e-21	76.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPD2`	Arabidopsis thaliana	Flap endonuclease GEN-like 1	45.566%	Swiss-Prot	moderate database homology
`Q64MA3`	Oryza sativa subsp. japonica	Flap endonuclease GEN-like 1	41.620%	Swiss-Prot	moderate database homology
`Q8W5R1`	Oryza sativa subsp. japonica	Single-strand DNA endonuclease 1	42.105%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card