LXL04_033095 | RubberDandelionOmics

Gene overview

LXL04_033095

Reference: OH-1004 Chr: Chr07 Coordinates: 35806248-35807507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1128 bp · LXL04_033095|LXL04_033095|OH1004|cDNA

ATGACCGATCACAACCATCATTCAGCCGGTATCAATAAGTTCGCCGGCCGACTACACCTCTCTCAAGATATTCGAACTCGTTATGACGCCTTTCAAAGCCCTGTAGCGAGTCAGAGACAATTCACAGACGGAAGTTCTTCAAATGCAGGGTTGCAGTCATTGGTAGCTGCAAATGCTTCCCCAGTTTTCGTTCAAGCTCCATCTGAAAAAGGTTTGGCCGGATTTGCCATTGATTTCCTCATGGGCGGAGTTTCAGGCGC...

CDS

Download CDS FASTA

1128 bp · LXL04_033095|LXL04_033095|OH1004|CDS

ATGACCGATCACAACCATCATTCAGCCGGTATCAATAAGTTCGCCGGCCGACTACACCTCTCTCAAGATATTCGAACTCGTTATGACGCCTTTCAAAGCCCTGTAGCGAGTCAGAGACAATTCACAGACGGAAGTTCTTCAAATGCAGGGTTGCAGTCATTGGTAGCTGCAAATGCTTCCCCAGTTTTCGTTCAAGCTCCATCTGAAAAAGGTTTGGCCGGATTTGCCATTGATTTCCTCATGGGCGGAGTTTCAGGCGC...

Protein

Download Protein FASTA

375 aa · LXL04_033095|LXL04_033095|OH1004|PROTEIN

MTDHNHHSAGINKFAGRLHLSQDIRTRYDAFQSPVASQRQFTDGSSSNAGLQSLVAANASPVFVQAPSEKGLAGFAIDFLMGGVSGAVSKTAAAPIERVKLLVQNQDELIKSGRLSEPYKGIGDCFSRTIKNEGVLSLWRGNTVNVIRYFPTQALNFAFKDQIKSMFNFKKDRDGYWKWFAGNLASGAAAGASSQLFVYSLDYARTRLTNDAKAAKKGGERQFNGLIDVYKKTLATDGIAGLYRGFNISIAGIVVYRGLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033095`
TK1151 ID	TkA08G229970
OH-1004 ID	LXL04_033095
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033095

Location Chr07:35806248-35807507 (+)

Description Similar to ANT: ADP,ATP carrier protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13490`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0718900`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033095 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015865 purine nucleotide transport Biological Process

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005757 mitochondrial permeability transition pore complex Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005471 ATP:ADP antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G13490

ghi:107926278

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.924

Rank 1 · LXL04_033095 · OH-1004

Cytoplasm0.036

Rank 2 · LXL04_033095 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_033095 · OH-1004

Nucleus0.024

Rank 4 · LXL04_033095 · OH-1004

Plastid0.022

Rank 5 · LXL04_033095 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr75-170 aa

PF00153.33Mito_carr178-272 aa

PF00153.33Mito_carr278-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033095	`PF00153.33`	Mito_carr	75	170	1.9e-69	230.2
LXL04_033095	`PF00153.33`	Mito_carr	178	272	1.9e-69	230.2
LXL04_033095	`PF00153.33`	Mito_carr	278	366	1.9e-69	230.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P40941`	Arabidopsis thaliana	ADP/ATP translocase 2, mitochondrial	75.325%	Swiss-Prot	strong database homology
`P31691`	Oryza sativa subsp. japonica	ADP/ATP translocase, mitochondrial	73.107%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card