LXL04_033060 | RubberDandelionOmics

Gene overview

LXL04_033060

Reference: OH-1004 Chr: Chr07 Coordinates: 35222012-35222687 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

461 bp · LXL04_033060|LXL04_033060|OH1004|cDNA

ATGGCTGGAGGAAAAGGGCAAATGGAGGTGCTTCATTTTTGTGTTACCGTCAATGCTTTCATCGTGTTCATATCTaggtcttcttcttcctctggTTCTTCTATCTGGAACCGATTTTATGGAGACAGCGAACAGAGGGCTGAGGGGGGAAGAACCTCTCGCAGGCAAAATAACTTTCAGGAACAAGGAAGAATGGGGGTGAGTGGTGATCTGTTGCAGGTGGATTCAAGGCTTCACGATTATCATCAAATTATCAAGCG...

CDS

Download CDS FASTA

420 bp · LXL04_033060|LXL04_033060|OH1004|CDS

ATGGCTGGAGGAAAAGGGCAAATGGAGGTGCTTCATTTTTGTGTTACCGTCAATGCTTTCATCGTGTTCATATCTAGGTCTTCTTCTTCCTCTGGTTCTTCTATCTGGAACCGATTTTATGGAGACAGCGAACAGAGGGCTGAGGGGGGAAGAACCTCTCGCAGGCAAAATAACTTTCAGGAACAAGGAAGAATGGGGGTGAGTGGTGATCTGTTGCAGGTGGATTCAAGGCTTCACGATTATCATCAAATTATCAAGCG...

Protein

Download Protein FASTA

139 aa · LXL04_033060|LXL04_033060|OH1004|PROTEIN

MAGGKGQMEVLHFCVTVNAFIVFISRSSSSSGSSIWNRFYGDSEQRAEGGRTSRRQNNFQEQGRMGVSGDLLQVDSRLHDYHQIIKRLMDLGTVKSNRSKCLYSSPLDFNSGLRLVFGNAMLFNQMRFTAWRNWEPNTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033060`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033060

Location Chr07:35222012-35222687 (-)

Description Similar to GTE3: Transcription factor GTE3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73150`	Probable transcription factor that binds to acetylated histone H3.	The PHD domain of plant PIAS proteins mediates sumoylation of bromodomain GTE proteins.2008 · DOI: 10.1074/jbc.m708176200
`At1g17790`	Transcription factor GTE5, chloroplastic.	No verified direct reference in this release
`At5g65630`	Transcription factor GTE7.	No verified direct reference in this release
`At5g10550`	Transcription factor GTE2.	No verified direct reference in this release
`At1g06230`	Involved in the activation and maintenance of cell division in the meristems and by this controls cell numbers in differentiated organs.	The Arabidopsis BET bromodomain factor GTE4 is involved in maintenance of the mitotic cell cycle during plant development.2010 · DOI: 10.1104/pp.109.150631 The Arabidopsis BET bromodomain factor GTE4 regulates the mitotic cell cycle.2010 · DOI: 10.4161/psb.5.6.11571

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033060 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045931 positive regulation of mitotic cell cycle Biological Process

GO:0048364 root development Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06230

ath:AT1G17790

ath:AT1G73150

ath:AT5G10550

ath:AT5G65630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.567

Rank 1 · LXL04_033060 · OH-1004

Cytoplasm0.348

Rank 2 · LXL04_033060 · OH-1004

Mitochondrion0.079

Rank 3 · LXL04_033060 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_033060 · OH-1004

Cell membrane0.057

Rank 5 · LXL04_033060 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00439.31Bromodomain76-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033060	`PF00439.31`	Bromodomain	76	128	7e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7T1`	Arabidopsis thaliana	Transcription factor GTE3, chloroplastic	65.957%	Swiss-Prot	weak database homology
`Q8H1D7`	Arabidopsis thaliana	Transcription factor GTE5, chloroplastic	54.545%	Swiss-Prot	weak database homology
`Q7Y214`	Arabidopsis thaliana	Transcription factor GTE7	59.574%	Swiss-Prot	weak database homology
`Q9LXA7`	Arabidopsis thaliana	Transcription factor GTE2	61.702%	Swiss-Prot	weak database homology
`Q9LNC4`	Arabidopsis thaliana	Transcription factor GTE4	53.191%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card