LXL04_033050 | RubberDandelionOmics

Gene overview

LXL04_033050

Reference: OH-1004 Chr: Chr07 Coordinates: 35100989-35102648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · LXL04_033050|LXL04_033050|OH1004|cDNA

ATGTTCAAGTTCTGGGGATCTCAAGAGCAACAAGCTTCTCCAAGGCCACAGGAAACTAACACTAACTCATGGTATCCTCCATCTGTTAGTTCATCAAGTTCATCCGGCTCTCCTCTTCCTTATAACTACAATTCTAACACATACACAGAAAGACTCGAAGATCAATCTCACTTACAATCTCATGTATCTGAATCTCCAATTGTATATCTAAAAGACAAAAGTGTTGATGAGTTACGGAGGCTTTTATCTGACCAGGTGGC...

CDS

Download CDS FASTA

756 bp · LXL04_033050|LXL04_033050|OH1004|CDS

ATGTTCAAGTTCTGGGGATCTCAAGAGCAACAAGCTTCTCCAAGGCCACAGGAAACTAACACTAACTCATGGTATCCTCCATCTGTTAGTTCATCAAGTTCATCCGGCTCTCCTCTTCCTTATAACTACAATTCTAACACATACACAGAAAGACTCGAAGATCAATCTCACTTACAATCTCATGTATCTGAATCTCCAATTGTATATCTAAAAGACAAAAGTGTTGATGAGTTACGGAGGCTTTTATCTGACCAGGTGGC...

Protein

Download Protein FASTA

251 aa · LXL04_033050|LXL04_033050|OH1004|PROTEIN

MFKFWGSQEQQASPRPQETNTNSWYPPSVSSSSSSGSPLPYNYNSNTYTERLEDQSHLQSHVSESPIVYLKDKSVDELRRLLSDQVAYQQFLLSIDPVRIQNNLRDELQKETLQLARKNLEREPQITELKNQVSLSFSSQMEWNQSNGIGIQDSIPWHCMIIRTSELASAQEKLHELKRKTQLFQCYSPGSLLDKLQESMNKTDEESERLHEQLLGKEIDLATFTQKYKKLRIIYHKQSLTYLAAKTSVAG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033050`
TK1151 ID	TkA08G227720
OH-1004 ID	LXL04_033050
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033050

Location Chr07:35100989-35102648 (+)

Description Similar to VPS37-1: Vacuolar protein-sorting-associated protein 37 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53120`	Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process.	No verified direct reference in this release
`At2g36680`	Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033050 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006623 protein targeting to vacuole Biological Process

GO:0016236 macroautophagy Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0039702 viral budding via host ESCRT complex Biological Process

GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0090148 membrane fission Biological Process

GO:0000813 ESCRT I complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G36680

ath:AT3G53120

hsa:55048

mmu:107305

pon:100172801

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.620

Rank 1 · LXL04_033050 · OH-1004

Nucleus0.357

Rank 2 · LXL04_033050 · OH-1004

Golgi apparatus0.083

Rank 3 · LXL04_033050 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_033050 · OH-1004

Cell membrane0.064

Rank 5 · LXL04_033050 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07200.19Mod_r71-138 aa

PF07200.19Mod_r162-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033050	`PF07200.19`	Mod_r	71	138	2e-27	96.7
LXL04_033050	`PF07200.19`	Mod_r	162	240	2e-27	96.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCP9`	Arabidopsis thaliana	Vacuolar protein-sorting-associated protein 37 homolog 1	52.988%	Swiss-Prot	strong database homology
`Q3EBL9`	Arabidopsis thaliana	Vacuolar protein-sorting-associated protein 37 homolog 2	49.421%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card