LXL04_033016 | RubberDandelionOmics

Gene overview

LXL04_033016

Reference: OH-1004 Chr: Chr07 Coordinates: 33475265-33478878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · LXL04_033016|LXL04_033016|OH1004|cDNA

ATGTTTCTGTTTCTGTTATTGTTTCAGATGGTGTCTGATGCAAGCAAGAAGAAGGCGGCTCAGAAGAAGGCTGCAGCTGCCGCTAAGAGAGGAGCTAAGGCCGTTGCTGCTGCCGCGTCGAAGAAGGCTGCGGCAATCGGTACGGTGAACGGGAGTTCTAGCTCCGATAATTTGTCGAATGCGATGGGGTCTTTTGCGATTTCTGATCGTACGTGTACTGGAGTTCTTTGTTCTCATCCTTTGTCTAGAGATATTCGGAT...

CDS

Download CDS FASTA

1833 bp · LXL04_033016|LXL04_033016|OH1004|CDS

ATGTTTCTGTTTCTGTTATTGTTTCAGATGGTGTCTGATGCAAGCAAGAAGAAGGCGGCTCAGAAGAAGGCTGCAGCTGCCGCTAAGAGAGGAGCTAAGGCCGTTGCTGCTGCCGCGTCGAAGAAGGCTGCGGCAATCGGTACGGTGAACGGGAGTTCTAGCTCCGATAATTTGTCGAATGCGATGGGGTCTTTTGCGATTTCTGATCGTACGTGTACTGGAGTTCTTTGTTCTCATCCTTTGTCTAGAGATATTCGGAT...

Protein

Download Protein FASTA

610 aa · LXL04_033016|LXL04_033016|OH1004|PROTEIN

MFLFLLLFQMVSDASKKKAAQKKAAAAAKRGAKAVAAAASKKAAAIGTVNGSSSSDNLSNAMGSFAISDRTCTGVLCSHPLSRDIRIESLSLTFHGHDLIVDSELELNYGRRYGLLGLNGCGKSTLLTSIGCRELPIPQHMDIFHLTREIEASDTSSLEAVINCDQERLKLEQEAEHLIGQDDGGGEALERVYERLDAMDVSTAEKRAAEILNGLGFTKTMQQKRTRDFSGGWRMRIALARALFMNPTILLLDEPTNHLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033016`
TK1151 ID	TkA08G220940
OH-1004 ID	LXL04_033016
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033016

Location Chr07:33475265-33478878 (+)

Description Similar to ABCF1: ABC transporter F family member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60790`	ABC transporter F family member 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033016 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000056 ribosomal small subunit export from nucleus Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0043335 protein unfolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G60790

bta:513061

hsa:10061

hsa:114483834

mmu:27407

sce:YER036C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · LXL04_033016 · OH-1004

Nucleus0.440

Rank 2 · LXL04_033016 · OH-1004

Mitochondrion0.074

Rank 3 · LXL04_033016 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_033016 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_033016 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran103-257 aa

PF12848.14ABC_tran_Xtn296-369 aa

PF00005.34ABC_tran413-543 aa

PF13304.13AAA_21504-570 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033016	`PF00005.34`	ABC_tran	103	257	3.6e-46	157.9
LXL04_033016	`PF12848.14`	ABC_tran_Xtn	296	369	3.4e-22	79.0
LXL04_033016	`PF00005.34`	ABC_tran	413	543	3.6e-46	157.9
LXL04_033016	`PF13304.13`	AAA_21	504	570	7.5e-17	62.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJH6`	Arabidopsis thaliana	ABC transporter F family member 1	83.755%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card