LXL04_033011 | RubberDandelionOmics

Gene overview

LXL04_033011

Reference: OH-1004 Chr: Chr07 Coordinates: 33405990-33407413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · LXL04_033011|LXL04_033011|OH1004|cDNA

aTGGGAAGAGCACCTTGTTGTGACAAAACAAGTGTGAAGAAAGGTCCATGGTCTCCTGAAGAAGATGCAAAGCTCAAAGAGTTTATAAACAAACATGGTACTGGTGGTAATTGGATCGCTCTTCCTCACAAGGCTGGTCTAAAAAGATGTGGGAAGAGTTGCAGGTTGAGATGGTTAAACTATCTAAGACCCAATATCAAACATGGTGAATTCTCCGAAGATGAAGATAGGATCATCTGCAGCTTGTATGCTAGCATTGG...

CDS

Download CDS FASTA

1101 bp · LXL04_033011|LXL04_033011|OH1004|CDS

ATGGGAAGAGCACCTTGTTGTGACAAAACAAGTGTGAAGAAAGGTCCATGGTCTCCTGAAGAAGATGCAAAGCTCAAAGAGTTTATAAACAAACATGGTACTGGTGGTAATTGGATCGCTCTTCCTCACAAGGCTGGTCTAAAAAGATGTGGGAAGAGTTGCAGGTTGAGATGGTTAAACTATCTAAGACCCAATATCAAACATGGTGAATTCTCCGAAGATGAAGATAGGATCATCTGCAGCTTGTATGCTAGCATTGG...

Protein

Download Protein FASTA

366 aa · LXL04_033011|LXL04_033011|OH1004|PROTEIN

MGRAPCCDKTSVKKGPWSPEEDAKLKEFINKHGTGGNWIALPHKAGLKRCGKSCRLRWLNYLRPNIKHGEFSEDEDRIICSLYASIGSRWSIIAGQLPGRTDNDIKNYWNTKLRKKLLAMLPSFQKKPSFLPNFPLQSSPLSDHHKYSDNFLNTSSSSFYNNPNNFMNVGNSLLTTAGSSLVHDHMNVTDLFPPPPPPPNPLIGMISNNNYHPGFQGDHQIMNKEYYYYPEVKEKMLMFGGGGELSTTCSSSDGGGGSCM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033011`
TK1151 ID	TkA08G220830
OH-1004 ID	LXL04_033011
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033011

Location Chr07:33405990-33407413 (+)

Description Similar to MYB36: Transcription factor MYB36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57620`	Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis.	MYB36 regulates the transition from proliferation to differentiation in the Arabidopsis root.2015 · DOI: 10.1073/pnas.1515576112
`At2g36890`	Transcription activator (By similarity).	No verified direct reference in this release
`At3g49690`	Transcription activator (By similarity).	Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.2006 · DOI: 10.1105/tpc.105.038745
`At5g23000`	Transcription activator of genes involved in the regulation of meristematic competence, such as CUC2.	Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.2006 · DOI: 10.1105/tpc.105.038745 Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.2006 · DOI: 10.1105/tpc.105.038588
`At4g37780`	Transcription factor that functions as a regulator of genes affecting cell wall organization and remodeling.	Chimeric repressor analysis identifies MYB87 as a possible regulator of morphogenesis via cell wall organization and remodeling in Arabidopsis.2014 · DOI: 10.1007/s10529-013-1451-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045597 positive regulation of cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050801 monoatomic ion homeostasis Biological Process

GO:0090506 axillary shoot meristem initiation Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

KEGG gene cross-reference

ath:AT2G36890

ath:AT3G49690

ath:AT4G37780

ath:AT5G23000

ath:AT5G57620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · LXL04_033011 · OH-1004

Cytoplasm0.109

Rank 2 · LXL04_033011 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_033011 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_033011 · OH-1004

Mitochondrion0.008

Rank 5 · LXL04_033011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-62 aa

PF13921.13Myb_DNA-bind_617-77 aa

PF00249.38Myb_DNA-binding69-111 aa

PF13921.13Myb_DNA-bind_671-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033011	`PF00249.38`	Myb_DNA-binding	14	62	2.5e-31	108.2
LXL04_033011	`PF13921.13`	Myb_DNA-bind_6	17	77	1.7e-17	64.0
LXL04_033011	`PF00249.38`	Myb_DNA-binding	69	111	2.5e-31	108.2
LXL04_033011	`PF13921.13`	Myb_DNA-bind_6	71	116	1.7e-17	64.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKL2`	Arabidopsis thaliana	Transcription factor MYB36	64.835%	Swiss-Prot	weak database homology
`Q9SJL7`	Arabidopsis thaliana	Transcription factor RAX2	80.992%	Swiss-Prot	weak database homology
`Q9M2Y9`	Arabidopsis thaliana	Transcription factor RAX3	83.898%	Swiss-Prot	weak database homology
`Q9FG68`	Arabidopsis thaliana	Transcription factor RAX1	83.051%	Swiss-Prot	weak database homology
`F4JSU0`	Arabidopsis thaliana	Transcription factor MYB87	78.992%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card