LXL04_033010 | RubberDandelionOmics

Gene overview

LXL04_033010

Reference: OH-1004 Chr: Chr07 Coordinates: 33381259-33382319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_033010|LXL04_033010|OH1004|cDNA

ATGGAGAAAGTGAGAAACATGTTTATGGCGAAACCTAATCCACAGCACTTATTACGCGATTGGCAACGCCGTCTCCGGCAAGAGTGCCGCAACATCGATCGTCAAATTCGTGATATCCAGCGAGAAGAGAAAATTGTCCAGAAAGCAATCCGAGAGGCTGCTAAAAGAAATGATATGAACTCTGCTAGGTCACTTGCCATGGAAATTGTGAGATCCAAAAAAACTGTCAATCGCCTCTATGAAAATAAAGCTCAATTAAA...

CDS

Download CDS FASTA

666 bp · LXL04_033010|LXL04_033010|OH1004|CDS

ATGGAGAAAGTGAGAAACATGTTTATGGCGAAACCTAATCCACAGCACTTATTACGCGATTGGCAACGCCGTCTCCGGCAAGAGTGCCGCAACATCGATCGTCAAATTCGTGATATCCAGCGAGAAGAGAAAATTGTCCAGAAAGCAATCCGAGAGGCTGCTAAAAGAAATGATATGAACTCTGCTAGGTCACTTGCCATGGAAATTGTGAGATCCAAAAAAACTGTCAATCGCCTCTATGAAAATAAAGCTCAATTAAA...

Protein

Download Protein FASTA

221 aa · LXL04_033010|LXL04_033010|OH1004|PROTEIN

MEKVRNMFMAKPNPQHLLRDWQRRLRQECRNIDRQIRDIQREEKIVQKAIREAAKRNDMNSARSLAMEIVRSKKTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKIVNDLMKAPEMAVTMQEFSKEMIKAGVIEQMVNDVVDSALDSDVMEDEIEEEVDKVLTSIAGETAVQLPEAARNVKVKRPAEVAEEPGGVDDEELEEIRARLAKVRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033010`
TK1151 ID	TkA08G220730
OH-1004 ID	LXL04_033010
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033010

Location Chr07:33381259-33382319 (+)

Description Similar to VPS24-1: Vacuolar protein sorting-associated protein 24 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22950`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At3g45000`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033010 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0015031 protein transport Biological Process

GO:0031468 nuclear membrane reassembly Biological Process

GO:0032509 endosome transport via multivesicular body sorting pathway Biological Process

GO:0039702 viral budding via host ESCRT complex Biological Process

GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0046761 viral budding from plasma membrane Biological Process

GO:0061952 midbody abscission Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

GO:0071985 multivesicular body sorting pathway Biological Process

GO:0097352 autophagosome maturation Biological Process

KEGG gene cross-reference

ath:AT3G45000

ath:AT5G22950

pon:100172572

xtr:548983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.837

Rank 1 · LXL04_033010 · OH-1004

Nucleus0.264

Rank 2 · LXL04_033010 · OH-1004

Mitochondrion0.051

Rank 3 · LXL04_033010 · OH-1004

Peroxisome0.048

Rank 4 · LXL04_033010 · OH-1004

Cell membrane0.047

Rank 5 · LXL04_033010 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03357.27Snf721-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033010	`PF03357.27`	Snf7	21	185	6.6e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFB3`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 24 homolog 1	73.799%	Swiss-Prot	strong database homology
`Q9LXH5`	Arabidopsis thaliana	Putative vacuolar protein sorting-associated protein 24 homolog 2	63.819%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card