LXL04_032987 | RubberDandelionOmics

Gene overview

LXL04_032987

Reference: OH-1004 Chr: Chr07 Coordinates: 32888795-32889585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · LXL04_032987|LXL04_032987|OH1004|cDNA

AAATAAAGTAATAACTTTAAAAAACACTATATGTAAGTGAAAGAAGTCTCCCCGGTGTATCGCATTCTTCCTATTATTTACAACATCACGACGCTCTCCCTCTCGCTCACTTAACAGGATTTTGATAAACTCTGAAGAATCAAATTGATTATGGGTCAGATCCAATACTCCGAGAAGTACTTCGATGATACGTTCGAGTATAGGCATGTAGTTCTTCCTCCAGAAGTCGCGAAGCTTCTCCCGAAGAATCGTCTTCTAGC...

CDS

Download CDS FASTA

279 bp · LXL04_032987|LXL04_032987|OH1004|CDS

TTGATTATGGGTCAGATCCAATACTCCGAGAAGTACTTCGATGATACGTTCGAGTATAGGCATGTAGTTCTTCCTCCAGAAGTCGCGAAGCTTCTCCCGAAGAATCGTCTTCTAGCCGAGACGGAATGGCGAGCAATTGGGGTGCAGCAGAGTCGAGGATGGGTGCACTATGCGATCCACAGACCAGAGCCACACATCATGCTGTTCAGGAGGCCGCTTAACTACCAGCAAAACCAAGAGAACCAGGCTCAGGCTCACCA...

Protein

Download Protein FASTA

92 aa · LXL04_032987|LXL04_032987|OH1004|PROTEIN

MIMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLAETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQAHQGLLAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032987`
TK1151 ID	TkA01G068740
OH-1004 ID	LXL04_032987
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 37.791 / OH-1004 70.652 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032987

Location Chr07:32888795-32889585 (+)

Description Similar to CKS2: Cyclin-dependent kinases regulatory subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27970`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release
`At2g27960`	Associates with cyclin-dependent kinases (CDKs) and plays an essential role in the regulation of the cell cycle that affects plant growth rate.	CKS1At overexpression in Arabidopsis thaliana inhibits growth by reducing meristem size and inhibiting cell-cycle progression.2001 · DOI: 10.1046/j.1365-313x.2001.00996.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0146300`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release
`UniProt: A2XCH8`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0051301 cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G27960

ath:AT2G27970

dosa:Os03g0146300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.496

Rank 1 · LXL04_032987 · OH-1004

Cytoplasm0.447

Rank 2 · LXL04_032987 · OH-1004

Mitochondrion0.138

Rank 3 · LXL04_032987 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_032987 · OH-1004

Endoplasmic reticulum0.026

Rank 5 · LXL04_032987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01111.25CKS6-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032987	`PF01111.25`	CKS	6	72	1.4e-36	125.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJJ5`	Arabidopsis thaliana	Cyclin-dependent kinases regulatory subunit 2	91.463%	Swiss-Prot	strong database homology
`O23249`	Arabidopsis thaliana	Cyclin-dependent kinases regulatory subunit 1	95.775%	Swiss-Prot	strong database homology
`Q6PS57`	Oryza sativa subsp. japonica	Cyclin-dependent kinases regulatory subunit 1	85.556%	Swiss-Prot	strong database homology
`A2XCH8`	Oryza sativa subsp. indica	Cyclin-dependent kinases regulatory subunit 1	85.556%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card