LXL04_032973 | RubberDandelionOmics

Gene overview

LXL04_032973

Reference: OH-1004 Chr: Chr07 Coordinates: 32582611-32585788 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2268 bp · LXL04_032973|LXL04_032973|OH1004|cDNA

ATGGCTACTGACAAAAGCAAACAACACAAAGTCCACATCATACCACCACACGATCTTCTTGTGCAGAAGTTTACAGAATCGCGAGCTCCAGAACTCGATTCTCTCTACTCCACCATTGCCACACGGTCAAACAACAATTTCAAATCTCAGAGAAACAAAAGGAGAAGAACTACTAGCCATGACAACCAATCCTCCAAAACTAGATTCAGAAAGAAGCAAAAAACGGGAGTTTTAAACCAAAATAATGATGTAAATTCAGT...

CDS

Download CDS FASTA

2268 bp · LXL04_032973|LXL04_032973|OH1004|CDS

ATGGCTACTGACAAAAGCAAACAACACAAAGTCCACATCATACCACCACACGATCTTCTTGTGCAGAAGTTTACAGAATCGCGAGCTCCAGAACTCGATTCTCTCTACTCCACCATTGCCACACGGTCAAACAACAATTTCAAATCTCAGAGAAACAAAAGGAGAAGAACTACTAGCCATGACAACCAATCCTCCAAAACTAGATTCAGAAAGAAGCAAAAAACGGGAGTTTTAAACCAAAATAATGATGTAAATTCAGT...

Protein

Download Protein FASTA

755 aa · LXL04_032973|LXL04_032973|OH1004|PROTEIN

MATDKSKQHKVHIIPPHDLLVQKFTESRAPELDSLYSTIATRSNNNFKSQRNKRRRTTSHDNQSSKTRFRKKQKTGVLNQNNDVNSVKKAPPRHIRRRKELNENPQNEFCTSGNGTKRLRTHVWHAKRFTMTTRWGFHLPLGLHGRGRGSRALLKWLNNGTVVHDASYYSAVQLEGSQDSIMSILSILMSPFPSSDSENVLSGGVYATSMLHHGGQPNSGAIAPVIYMWRLNQKSTDADLELNGSEDHEKVNSSSSFRQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032973`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032973

Location Chr07:32582611-32585788 (+)

Description Similar to POP1: Ribonucleases P/MRP protein subunit POP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47300`	Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032973 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001682 tRNA 5'-leader removal Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0008033 tRNA processing Biological Process

GO:0016078 tRNA decay Biological Process

GO:0000172 ribonuclease MRP complex Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005655 nucleolar ribonuclease P complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030681 multimeric ribonuclease P complex Cellular Component

KEGG gene cross-reference

ath:AT2G47300

cel:CELE_C05D11.9

hsa:10940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.947

Rank 1 · LXL04_032973 · OH-1004

Cytoplasm0.079

Rank 2 · LXL04_032973 · OH-1004

Mitochondrion0.023

Rank 3 · LXL04_032973 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_032973 · OH-1004

Plastid0.016

Rank 5 · LXL04_032973 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06978.17POP1_N115-176 aa

PF08170.18POPLD439-515 aa

PF22770.3POP1_C659-744 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032973	`PF06978.17`	POP1_N	115	176	1.1e-13	52.3
LXL04_032973	`PF08170.18`	POPLD	439	515	1.3e-14	55.0
LXL04_032973	`PF22770.3`	POP1_C	659	744	3e-12	47.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IL30`	Arabidopsis thaliana	Ribonucleases P/MRP protein subunit POP1	44.458%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card