Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1761 bp · LXL04_032955|LXL04_032955|OH1004|cDNA
tttTAGGTTTCAATGGAATATCCCCTATTTAAACATAACACTCTTTCTTCCGCCTTTCTTAAACCCTAGACCCTCTTCTTCACCTCTTCATTCCAAGGTAAAGCCCATTTTCAGGTGTAATCGTGCAGAGGGATCAAGAGAATGTTGGTGCTTTTCGAAACCCCAGCGGGGTTCGCCCTTTTTAAAGTCCTCGATGAAGGAAAACTCTCTAAAGTCGATGATTTGTGGAAGGATTTCTCATCCGCCGACACAGCCAGACA...
1620 bp · LXL04_032955|LXL04_032955|OH1004|CDS
ATGTTGGTGCTTTTCGAAACCCCAGCGGGGTTCGCCCTTTTTAAAGTCCTCGATGAAGGAAAACTCTCTAAAGTCGATGATTTGTGGAAGGATTTCTCATCCGCCGACACAGCCAGACAGGTGGTAAAGCTAAAAGCTTTCTCCAAATTCGAGAACACATCAGAGGCACTTTCAGCAGCCACTCTGTTAATCGACAGCAAGCCCAGCAAAGGCTTGCGCAAGTTTTTACGCTCTCACTGCGAAGGGGAAACATTAGCTGT...
Protein
Download Protein FASTA539 aa · LXL04_032955|LXL04_032955|OH1004|PROTEIN
MLVLFETPAGFALFKVLDEGKLSKVDDLWKDFSSADTARQVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCEGETLAVADSKLGNAIKEKLQIDCVHNQTVMELMRGVRSQLTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMRVREWYGWHFPELAKIVQDNILYAKAVKLMGYRTNAAKLDFSEILSDEVETELKESAVVSMGTEVSDLDLTNIKDLCDQVL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032955 |
|---|---|
| TK1151 ID | TkA08G215950 |
| OH-1004 ID | LXL04_032955 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 87.300 |
| Protein coverage (%) | TK1151 81.405 / OH-1004 83.302Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032955 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:32260528-32262974 (+) | |||||||||
| Description | Similar to NOP5-2: Probable nucleolar protein 5-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000451 rRNA 2'-O-methylation Biological Process GO:0006364 rRNA processing Biological Process GO:0016556 mRNA modification Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0048254 snoRNA localization Biological Process GO:0001650 fibrillar center Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005732 sno(s)RNA-containing ribonucleoprotein complex Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G05060 ath:AT5G27120 hsa:51602 mcf:102131118 mmu:55989 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08156.19NOP5NT2-65 aaPF01798.24Nop166-394 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032955 | PF08156.19 | NOP5NT | 2 | 65 | 2.1e-18 | 67.2 |
| LXL04_032955 | PF01798.24 | Nop | 166 | 394 | 2e-85 | 286.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.