RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032918
Reference: OH-1004 Chr: Chr07 Coordinates: 31613926-31615242 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1317 bp · LXL04_032918|LXL04_032918|OH1004|cDNA

ATGTCTCTATACCTGCAAAACCAACAGCCCTTCAAAACTCTCTCTTTATTTTCTGACATGATCACGTCCACGGGGTTGAACCCAGACGGGCACTGCATCGTGGCTGCAATTTTAGCTTGTGGGTCTGCTAAGAATCTGGTTATGGGGAAGATTGTTCATGGGATGGTTTTCAGATACGAGTTGGGTGGTGAAAGAGACGGACCTATTGTTTCCAATGCTTTGATCGATCTGTACAGTCGAAATGGTAAGATAAGTTTAGC...

CDS

Download CDS FASTA

1317 bp · LXL04_032918|LXL04_032918|OH1004|CDS

ATGTCTCTATACCTGCAAAACCAACAGCCCTTCAAAACTCTCTCTTTATTTTCTGACATGATCACGTCCACGGGGTTGAACCCAGACGGGCACTGCATCGTGGCTGCAATTTTAGCTTGTGGGTCTGCTAAGAATCTGGTTATGGGGAAGATTGTTCATGGGATGGTTTTCAGATACGAGTTGGGTGGTGAAAGAGACGGACCTATTGTTTCCAATGCTTTGATCGATCTGTACAGTCGAAATGGTAAGATAAGTTTAGC...

Protein

Download Protein FASTA

438 aa · LXL04_032918|LXL04_032918|OH1004|PROTEIN

MSLYLQNQQPFKTLSLFSDMITSTGLNPDGHCIVAAILACGSAKNLVMGKIVHGMVFRYELGGERDGPIVSNALIDLYSRNGKISLAKRVFESMVDKDVASWTSFLNGHIVCGDIVSAGQVFDEMPVRNVISWTAMIVGYVRSKNVIHGLKLYREMITEYTHPTSITIVAVLSSCADIGALDFGGSLHGYVNKVQNLVTDVSVNNALIDMYCKGGNLELATRVFIKMYKRDVFSWTSMISRLALHGKGRSTLEMFDDMVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032918
TK1151 IDTkA08G213300
OH-1004 IDLXL04_032918
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032918
LocationChr07:31613926-31615242 (-)
DescriptionSimilar to PCMP-E28: Pentatricopeptide repeat-containing protein At2g22410, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g22410 Pentatricopeptide repeat-containing protein At2g22410, mitochondrial. No verified direct reference in this release
At2g13600 Pentatricopeptide repeat-containing protein At2g13600. No verified direct reference in this release
At2g29760 Involved in RNA editing event in chloroplasts.
A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472
At3g15930 Putative pentatricopeptide repeat-containing protein At3g15930. No verified direct reference in this release
At5g59200 Involved in RNA editing event in chloroplasts.
A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032918 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009451 RNA modification Biological Process
GO:0010182 sugar mediated signaling pathway Biological Process
GO:0016556 mRNA modification Biological Process
GO:0080156 mitochondrial mRNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference
ath:AT2G13600
ath:AT2G22410
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.603
Rank 1 · LXL04_032918 · OH-1004
Plastid0.220
Rank 2 · LXL04_032918 · OH-1004
Nucleus0.043
Rank 3 · LXL04_032918 · OH-1004
Cytoplasm0.032
Rank 4 · LXL04_032918 · OH-1004
Peroxisome0.006
Rank 5 · LXL04_032918 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535.27PPR72-98 aa
PF13041.13PPR_2128-176 aa
PF01535.27PPR131-158 aa
PF13041.13PPR_2200-232 aa
PF01535.27PPR205-231 aa
PF12854.14PPR_1205-227 aa
PF13041.13PPR_2230-278 aa
PF13812.13PPR_3230-278 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032918PF01535.27PPR72984.7e-44146.3
LXL04_032918PF13041.13PPR_21281767.2e-41138.8
LXL04_032918PF01535.27PPR1311584.7e-44146.3
LXL04_032918PF13041.13PPR_22002327.2e-41138.8
LXL04_032918PF01535.27PPR2052314.7e-44146.3
LXL04_032918PF12854.14PPR_12052276.6e-2793.7
LXL04_032918PF13041.13PPR_22302787.2e-41138.8
LXL04_032918PF13812.13PPR_32302782.6e-1763.4
LXL04_032918PF01535.27PPR2332634.7e-44146.3
LXL04_032918PF12854.14PPR_12983296.6e-2793.7
LXL04_032918PF20431.5E_motif3504107.4e-1865.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SJZ3Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g22410, mitochondrial38.903%Swiss-Protmoderate database homology
Q9SIT7Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g1360036.795%Swiss-Protmoderate database homology
O82380Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g29760, chloroplastic36.879%Swiss-Protmoderate database homology
Q9LSB8Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At3g1593038.278%Swiss-Protmoderate database homology
Q9FIF7Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At5g59200, chloroplastic37.264%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser