Gene Card
Gene overview
cDNA / CDS / Protein Sequences
507 bp · LXL04_032905|LXL04_032905|OH1004|cDNA
ATGGCAACAGCAACTTATCCACCTCCACCACCCTATTACAGACTGTACAAGGATTATGAACAGGACCCCACCTCTGCTCCAGAACCTCCCCCTCCCATTGAAGGAACTTACCTCCTATATGGTTCCAATTACACTACTGATGATGTATTGCCGAGTTTGGAGGACCAGGGTGTTCGCCAGCTGTACCCAAAAGGCCCAAATGTTGATTTCAAGAAGGAATTGAGGTCATTAAATAGGGAACTTCAACTGCATATCTTGGA...
507 bp · LXL04_032905|LXL04_032905|OH1004|CDS
ATGGCAACAGCAACTTATCCACCTCCACCACCCTATTACAGACTGTACAAGGATTATGAACAGGACCCCACCTCTGCTCCAGAACCTCCCCCTCCCATTGAAGGAACTTACCTCCTATATGGTTCCAATTACACTACTGATGATGTATTGCCGAGTTTGGAGGACCAGGGTGTTCGCCAGCTGTACCCAAAAGGCCCAAATGTTGATTTCAAGAAGGAATTGAGGTCATTAAATAGGGAACTTCAACTGCATATCTTGGA...
Protein
Download Protein FASTA168 aa · LXL04_032905|LXL04_032905|OH1004|PROTEIN
MATATYPPPPPYYRLYKDYEQDPTSAPEPPPPIEGTYLLYGSNYTTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKEALGTLEGQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032905 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032905 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:31505041-31505918 (+) | |||||||||
| Description | Similar to MED7B: Mediator of RNA polymerase II transcription subunit 7b | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009704 de-etiolation Biological Process GO:0051510 regulation of unidimensional cell growth Biological Process GO:0005634 nucleus Cellular Component GO:0016592 mediator complex Cellular Component GO:0070847 core mediator complex Cellular Component GO:0003712 transcription coregulator activity Molecular Function | |||||||||
| KEGG gene cross-reference | aag:5567840 aga:1273138 ath:AT5G03220 ath:AT5G03500 ddi:DDB_G0269568 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05983.17Med74-158 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032905 | PF05983.17 | Med7 | 4 | 158 | 1e-46 | 160.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.