LXL04_032892 | RubberDandelionOmics

Gene overview

LXL04_032892

Reference: OH-1004 Chr: Chr07 Coordinates: 31304650-31309189 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2946 bp · LXL04_032892|LXL04_032892|OH1004|cDNA

ATGTCAGGGTTGAAAACGGCGGTTTGGGTATTGTTGACGGGCCTGTTTCTAATCAGGGATGAAGTTGCAGGGCTGGGTGTGAACTGGGGGACGATGGCGTCGCATAAGATGGATCCGAAAACGGTGGTGCAAATGATGAAGGACAACGGGATTAATAAAGTGAAGCTGTTTGACGCCGAGCAATCGACGATGAGTGCACTCGCCGGCTCCGGCATAGAAGTTATGATCGCTATTCCGAACGATCAGCTCGCCGCCATGGG...

CDS

Download CDS FASTA

2946 bp · LXL04_032892|LXL04_032892|OH1004|CDS

ATGTCAGGGTTGAAAACGGCGGTTTGGGTATTGTTGACGGGCCTGTTTCTAATCAGGGATGAAGTTGCAGGGCTGGGTGTGAACTGGGGGACGATGGCGTCGCATAAGATGGATCCGAAAACGGTGGTGCAAATGATGAAGGACAACGGGATTAATAAAGTGAAGCTGTTTGACGCCGAGCAATCGACGATGAGTGCACTCGCCGGCTCCGGCATAGAAGTTATGATCGCTATTCCGAACGATCAGCTCGCCGCCATGGG...

Protein

Download Protein FASTA

981 aa · LXL04_032892|LXL04_032892|OH1004|PROTEIN

MSGLKTAVWVLLTGLFLIRDEVAGLGVNWGTMASHKMDPKTVVQMMKDNGINKVKLFDAEQSTMSALAGSGIEVMIAIPNDQLAAMGDYSRAKKFVQRNVTRYNFNGGVNIRYVAVGNEPFLTAYNGSNLKTTFPALQNIQNALNEAGHGDTVKATVPSNADVYGSPTDNPVPSAGRFRTDINDQMLQLVQFLAKNNAPFTVNIYPFLSLYGNDDFPVDYAFFDGAGQPIVDNGIQYTNVFDANYDTLVSALKVAGYGDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032892`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032892

Location Chr07:31304650-31309189 (+)

Description Similar to At1g64760: Glucan endo-1,3-beta-glucosidase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64760`	Glucan endo-1,3-beta-glucosidase 8.	No verified direct reference in this release
`At4g31140`	Glucan endo-1,3-beta-glucosidase 5.	No verified direct reference in this release
`At5g58090`	Glucan endo-1,3-beta-glucosidase 6.	No verified direct reference in this release
`At5g58480`	Glucan endo-1,3-beta-glucosidase 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032892 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64760

ath:AT4G31140

ath:AT5G58090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.508

Rank 1 · LXL04_032892 · OH-1004

Extracellular0.213

Rank 2 · LXL04_032892 · OH-1004

Lysosome / Vacuole0.093

Rank 3 · LXL04_032892 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_032892 · OH-1004

Cytoplasm0.087

Rank 5 · LXL04_032892 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1725-344 aa

PF29664.1BtgE-BtgC_glyc-hydro238-331 aa

PF07983.19X8367-436 aa

PF00332.25Glyco_hydro_17511-826 aa

PF29664.1BtgE-BtgC_glyc-hydro529-816 aa

PF07983.19X8851-921 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032892	`PF00332.25`	Glyco_hydro_17	25	344	3.1e-118	395.6
LXL04_032892	`PF29664.1`	BtgE-BtgC_glyc-hydro	238	331	3.3e-27	96.0
LXL04_032892	`PF07983.19`	X8	367	436	4e-31	108.2
LXL04_032892	`PF00332.25`	Glyco_hydro_17	511	826	3.1e-118	395.6
LXL04_032892	`PF29664.1`	BtgE-BtgC_glyc-hydro	529	816	3.3e-27	96.0
LXL04_032892	`PF07983.19`	X8	851	921	4e-31	108.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKW9`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 8	72.368%	Swiss-Prot	weak database homology
`Q9M088`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 5	52.621%	Swiss-Prot	weak database homology
`Q93Z08`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 6	54.483%	Swiss-Prot	weak database homology
`Q9FGH4`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 9	42.634%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card