LXL04_032890 | RubberDandelionOmics

Gene overview

LXL04_032890

Reference: OH-1004 Chr: Chr07 Coordinates: 31271607-31273186 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · LXL04_032890|LXL04_032890|OH1004|cDNA

ATAAAGATGTATCATCATCATAATCATCAAGGAAAGAACATCCAGCAGTCTTCTTCAAGAATGTCAATTACACCAGAAAGACATTTGTTTCTACAAGGTGGGGGCGATTCTGGACTTGTTCTATCAACAGATGCTAAACCAAGACTCAAATGGACACCAGATCTCCATGAAAGGTTCATAGAAGCAGTCAACCAGCTTGGAGGTGCAGATAAAGCTACTCCAAAATCAGTTTTAAAGCTAATGGGAATTCAAGGGCTTAC...

CDS

Download CDS FASTA

1119 bp · LXL04_032890|LXL04_032890|OH1004|CDS

ATGTATCATCATCATAATCATCAAGGAAAGAACATCCAGCAGTCTTCTTCAAGAATGTCAATTACACCAGAAAGACATTTGTTTCTACAAGGTGGGGGCGATTCTGGACTTGTTCTATCAACAGATGCTAAACCAAGACTCAAATGGACACCAGATCTCCATGAAAGGTTCATAGAAGCAGTCAACCAGCTTGGAGGTGCAGATAAAGCTACTCCAAAATCAGTTTTAAAGCTAATGGGAATTCAAGGGCTTACTTTGTA...

Protein

Download Protein FASTA

372 aa · LXL04_032890|LXL04_032890|OH1004|PROTEIN

MYHHHNHQGKNIQQSSSRMSITPERHLFLQGGGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLYRQTNSGGTNKVDMVTTAGDLNGETNGPHMSSSSVCPQTNKNLQISEAIQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETLGRQNLGTVGLEAAKSQLSELVSKVSTHCLNSAFNSGIKDVSMNTNQPTDCSIDSCLTYGDQGQQNEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032890`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032890

Location Chr07:31271607-31273186 (+)

Description Similar to MYR2: Myb-related protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04030`	Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation.	Transcripts of MYB-like genes respond to phosphorous and nitrogen deprivation in Arabidopsis.2004 · DOI: 10.1007/s00425-004-1305-7 The Arabidopsis Myb genes MYR1 and MYR2 are redundant negative regulators of flowering time under decreased light intensity.2011 · DOI: 10.1111/j.1365-313x.2011.04508.x
`At5g18240`	Transcription factor that may act on the GAL1 promoter.	Cloning by pathway activation in yeast: identification of an Arabidopsis thaliana F-box protein that can turn on glucose repression.2002 · DOI: 10.1023/a:1014440531842 The Arabidopsis Myb genes MYR1 and MYR2 are redundant negative regulators of flowering time under decreased light intensity.2011 · DOI: 10.1111/j.1365-313x.2011.04508.x
`At3g24120`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At4g13640`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At1g69580`	Myb family transcription factor PHL8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032890 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G69580

ath:AT3G04030

ath:AT3G24120

ath:AT4G13640

ath:AT5G18240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · LXL04_032890 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_032890 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_032890 · OH-1004

Endoplasmic reticulum0.010

Rank 4 · LXL04_032890 · OH-1004

Plastid0.008

Rank 5 · LXL04_032890 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding46-97 aa

PF14379.12Myb_CC_LHEQLE145-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032890	`PF00249.38`	Myb_DNA-binding	46	97	5.7e-10	39.9
LXL04_032890	`PF14379.12`	Myb_CC_LHEQLE	145	192	5.2e-24	84.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQQ9`	Arabidopsis thaliana	Myb-related protein 2	52.593%	Swiss-Prot	strong database homology
`Q9FK47`	Arabidopsis thaliana	Myb-related protein 1	50.739%	Swiss-Prot	strong database homology
`Q94A57`	Arabidopsis thaliana	Protein PHR1-LIKE 2	44.776%	Swiss-Prot	moderate database homology
`Q8LAJ7`	Arabidopsis thaliana	Protein PHR1-LIKE 3	45.238%	Swiss-Prot	moderate database homology
`F4I274`	Arabidopsis thaliana	Myb family transcription factor PHL8	54.822%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card