LXL04_032886 | RubberDandelionOmics

Gene overview

LXL04_032886

Reference: OH-1004 Chr: Chr07 Coordinates: 31147089-31149367 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_032886|LXL04_032886|OH1004|cDNA

ATGGAGAGCATAATACCCACATGGCAAGTGTCGTTTTTGTGTGGGGTTTTGACTTGGGTCGTTCTATCTTCGATGTTTAACGTGACCCAGAAGATTAGATCTTCGGTACAGCCATGGGTGTCTCGTCGTGTAATCTCCGGTACTTCAACTATTCTTCAGATCCAGAAATACCAGCATGGTTTTTGGGATGCTTTGTTCTCTGGGATATCTTGTGTTGTTTCTGTGCCCTTTTATACTGGCTTTCTTCCCTTGCTATTTTG...

CDS

Download CDS FASTA

1233 bp · LXL04_032886|LXL04_032886|OH1004|CDS

ATGGAGAGCATAATACCCACATGGCAAGTGTCGTTTTTGTGTGGGGTTTTGACTTGGGTCGTTCTATCTTCGATGTTTAACGTGACCCAGAAGATTAGATCTTCGGTACAGCCATGGGTGTCTCGTCGTGTAATCTCCGGTACTTCAACTATTCTTCAGATCCAGAAATACCAGCATGGTTTTTGGGATGCTTTGTTCTCTGGGATATCTTGTGTTGTTTCTGTGCCCTTTTATACTGGCTTTCTTCCCTTGCTATTTTG...

Protein

Download Protein FASTA

410 aa · LXL04_032886|LXL04_032886|OH1004|PROTEIN

MESIIPTWQVSFLCGVLTWVVLSSMFNVTQKIRSSVQPWVSRRVISGTSTILQIQKYQHGFWDALFSGISCVVSVPFYTGFLPLLFWSGHGKLARQMTLLMAFCDYSGNCIKDMVSAPRPKSPPVRILTATKDEKENALEYGFPSSHTLNTICLSGYLLHYVFSCNENINAYYQVATFMFVCLFVALIGFGRIYLGMHSVIDIIGGVILGLTILAFWLRVHEYIDNFVTLGQNVTSFWIALSFLLLFAYPTPEHPTPSFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032886`
TK1151 ID	TkA08G211300
OH-1004 ID	LXL04_032886
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032886

Location Chr07:31147089-31149367 (-)

Description Similar to LPPD: Lipid phosphate phosphatase delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58490`	Functions as a sphingoid long-chain base phosphate (LCBP) phosphatase.	Degradation of long-chain base 1-phosphate (LCBP) in Arabidopsis: functional characterization of LCBP phosphatase involved in the dehydration stress response.2012 · DOI: 10.1007/s10265-011-0451-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032886 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006665 sphingolipid metabolic process Biological Process

GO:0006670 sphingosine metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

GO:0061469 regulation of type B pancreatic cell proliferation Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0008117 sphinganine-1-phosphate aldolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G58490

mmu:433323

sce:YJL134W

sce:YKR053C

spo:2543496

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.730

Rank 1 · LXL04_032886 · OH-1004

Nucleus0.137

Rank 2 · LXL04_032886 · OH-1004

Cytoplasm0.083

Rank 3 · LXL04_032886 · OH-1004

Golgi apparatus0.075

Rank 4 · LXL04_032886 · OH-1004

Mitochondrion0.074

Rank 5 · LXL04_032886 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01569.28PAP297-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032886	`PF01569.28`	PAP2	97	223	3.9e-21	75.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2G7`	Arabidopsis thaliana	Lipid phosphate phosphatase delta	66.173%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card