LXL04_032836 | RubberDandelionOmics

Gene overview

LXL04_032836

Reference: OH-1004 Chr: Chr07 Coordinates: 30197742-30198071 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · LXL04_032836|LXL04_032836|OH1004|cDNA

ATGAGCCGGAGAAATGGTGGTGGCAGAGGTCCGACGCTTGACCTGAAACTGAATCTTTCGCCGCCAAGTGCTCGTCGGTCTACGACAGAATCACCAAACAGAGCAACCGCCATGTCTCCGACAAGCTCGTGTCTGACGTATGAACTCGTTCAAGATGAGACGCGCCGCCGCTACTCCACCAGCCCGGAGGCGACATCCATGATGTTGGTCGGATGTCCTCAGTGTCTTATGTATATTATGCTTTCCGAGGATTACCCTAA...

CDS

Download CDS FASTA

330 bp · LXL04_032836|LXL04_032836|OH1004|CDS

ATGAGCCGGAGAAATGGTGGTGGCAGAGGTCCGACGCTTGACCTGAAACTGAATCTTTCGCCGCCAAGTGCTCGTCGGTCTACGACAGAATCACCAAACAGAGCAACCGCCATGTCTCCGACAAGCTCGTGTCTGACGTATGAACTCGTTCAAGATGAGACGCGCCGCCGCTACTCCACCAGCCCGGAGGCGACATCCATGATGTTGGTCGGATGTCCTCAGTGTCTTATGTATATTATGCTTTCCGAGGATTACCCTAA...

Protein

Download Protein FASTA

109 aa · LXL04_032836|LXL04_032836|OH1004|PROTEIN

MSRRNGGGRGPTLDLKLNLSPPSARRSTTESPNRATAMSPTSSCLTYELVQDETRRRYSTSPEATSMMLVGCPQCLMYIMLSEDYPKCPKCKSTVLLDVVHNNANKTKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032836`
TK1151 ID	TkA08G208480
OH-1004 ID	LXL04_032836
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032836

Location Chr07:30197742-30198071 (-)

Description Similar to GIR1: Protein GL2-INTERACTING REPRESSOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06270`	Acts as a negative regulator of root hair development redundantly with GIR2.	No verified direct reference in this release
`At3g11600`	Acts as a negative regulator of root hair development redundantly with GIR1.	No verified direct reference in this release
`At5g22270`	Involved in ethylene-dependent salt stress responses by reducing reactive oxygen species (ROS) accumulation.	Salt-induced stabilization of EIN3/EIL1 confers salinity tolerance by deterring ROS accumulation in Arabidopsis.2014 · DOI: 10.1371/journal.pgen.1004664

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032836 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080147 root hair cell development Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G11600

ath:AT5G06270

ath:AT5G22270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · LXL04_032836 · OH-1004

Cytoplasm0.151

Rank 2 · LXL04_032836 · OH-1004

Cell membrane0.054

Rank 3 · LXL04_032836 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_032836 · OH-1004

Plastid0.013

Rank 5 · LXL04_032836 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24747.2Zn-ribbon_GIR166-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032836	`PF24747.2`	Zn-ribbon_GIR1	66	106	2.8e-24	85.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNI1`	Arabidopsis thaliana	Protein GL2-INTERACTING REPRESSOR 1	63.265%	Swiss-Prot	strong database homology
`Q9SRN4`	Arabidopsis thaliana	Protein GL2-INTERACTING REPRESSOR 2	54.808%	Swiss-Prot	strong database homology
`Q9FMS4`	Arabidopsis thaliana	Protein salt-induced and EIN3/EIL1-dependent 1	54.762%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card